Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT362RB)
DTT Name | MART-1 melanoma antigen (MLANA) | ||||
---|---|---|---|---|---|
Synonyms | Protein MelanA; Melanoma antigen recognized by Tcells 1; MLANA; MART1; Antigen SK29AA; Antigen LB39AA | ||||
Gene Name | MLANA | ||||
DTT Type |
Clinical trial target
|
[1] | |||
Related Disease |
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDK
SLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP |
||||
Function |
Involved in melanosome biogenesis by ensuring the stability of GPR143. Plays a vital role in the expression, stability, trafficking, and processing of melanocyte protein PMEL, which is critical to the formation of stage II melanosomes.
|
||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
4 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||||||||||||||
2 Discontinued Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||||||||||||||
Molecular Expression Atlas (MEA) of This DTT
References
1 | National Cancer Institute Drug Dictionary (drug id 685201). | ||||
---|---|---|---|---|---|
2 | Safety and immunogenicity of vaccination with MART-1 (26-35, 27L), gp100 (209-217, 210M), and tyrosinase (368-376, 370D) in-adjuvant with PF-3512676 and GM-CSF in metastatic melanoma. Correction in: volume 35 on page 650. | ||||
3 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. | ||||
4 | An immuno-oncology company developing a novel polyvalent antigen therapy for the treatment of melanoma. Polynoma. 2015. | ||||
5 | Preclinical qualification of a new multi-antigen candidate vaccine for metastatic melanoma. J Immunother. 2010 Oct;33(8):743-58. | ||||
6 | Stability and CTL-activity of P40/ELA melanoma vaccine candidate. Biologicals. 2001 Sep-Dec;29(3-4):293-8. | ||||