Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT362RB)

• DTT Name: MART-1 melanoma antigen (MLANA)
• Synonyms: Protein MelanA; Melanoma antigen recognized by Tcells 1; MLANA; MART1; Antigen SK29AA; Antigen LB39AA
• Gene Name: MLANA
• DTT Type: Clinical trial target; [1]
• UniProt ID: MAR1_HUMAN
• TTD ID: T75256
• Sequence:
  MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDK
  SLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
• Function: Involved in melanosome biogenesis by ensuring the stability of GPR143. Plays a vital role in the expression, stability, trafficking, and processing of melanocyte protein PMEL, which is critical to the formation of stage II melanosomes.

Molecular Interaction Atlas (MIA) of This DTT

4 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Melanoma vaccine	DMQEC6Z	Melanoma	2C30	Phase 3	[1]
Multi-epitope peptide melanoma vaccine	DMZPEHY	Melanoma	2C30	Phase 3	[2]
MKC-1106-MT	DMXKOW6	Melanoma	2C30	Phase 2	[3]
Polynoma-1	DM3QDA6	Melanoma	2C30	Phase 2	[4]

2 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Melanoma vaccine (ALVAC)	DM3HIQY	Melanoma	2C30	Discontinued in Phase 2	[5]
F-50040	DMMG6W5	Melanoma	2C30	Discontinued in Phase 1	[6]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Melanoma	2C82	Skin	3.29E-02	1.64	0.76

References

• [1] National Cancer Institute Drug Dictionary (drug id 685201).
• [2] Safety and immunogenicity of vaccination with MART-1 (26-35, 27L), gp100 (209-217, 210M), and tyrosinase (368-376, 370D) in-adjuvant with PF-3512676 and GM-CSF in metastatic melanoma. Correction in: volume 35 on page 650.
• [3] Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
• [4] An immuno-oncology company developing a novel polyvalent antigen therapy for the treatment of melanoma. Polynoma. 2015.
• [5] Preclinical qualification of a new multi-antigen candidate vaccine for metastatic melanoma. J Immunother. 2010 Oct;33(8):743-58.
• [6] Stability and CTL-activity of P40/ELA melanoma vaccine candidate. Biologicals. 2001 Sep-Dec;29(3-4):293-8.