Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT51DEV)

DTT Name Interleukin 1 receptor type 2 (IL1R2)
Synonyms
Interleukin-1 receptor type II; Interleukin-1 receptor type 2; Interleukin-1 receptor beta; Interleukin 1 receptor type II; IL1RB; IL-1RT2; IL-1RT-2; IL-1R-beta; IL-1R-2; IL-1 type II receptor; CDw121b; CD121b; CD121 antigen-like family member B; Antigen CDw121b
Gene Name IL1R2
DTT Type
Clinical trial target
 [1]
BioChemical Class
Cytokine receptor
UniProt ID
IL1R2_HUMAN
TTD ID
T23347
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MLRLYVLVMGVSAFTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWAS
VSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMS
IELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDN
EKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRSIELRIKKKKEETIPVII
SPLKTISASLGSRLTIPCKVFLGTGTPLTTMLWWTANDTHIESAYPGGRVTEGPRQEYSE
NNENYIEVPLIFDPVTREDLHMDFKCVVHNTLSFQTLRTTVKEASSTFSWGIVLAPLSLA
FLVLGGIWMHRRCKHRTGKADGLTVLWPHHQDFQSYPK
Function
Reduces IL1B activities. Serves as a decoy receptor by competetive binding to IL1B and preventing its binding to IL1R1. Also modulates cellular response through non-signaling association with IL1RAP after binding to IL1B. IL1R2 (membrane and secreted forms) preferentially binds IL1B and poorly IL1A and IL1RN. The secreted IL1R2 recruits secreted IL1RAP with high affinity; this complex formation may be the dominant mechanism for neutralization of IL1B by secreted/soluble receptors. Non-signaling receptor for IL1A, IL1B and IL1RN.
KEGG Pathway
MAPK signaling pathway (hsa04010 )
Cytokine-cytokine receptor interaction (hsa04060 )
Hematopoietic cell lineage (hsa04640 )
Amoebiasis (hsa05146 )
HTLV-I infection (hsa05166 )
Transcriptional misregulation in cancer (hsa05202 )
Reactome Pathway
Interleukin-1 signaling (R-HSA-446652 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
1 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
GSK-1827771 DMA41JD Rheumatoid arthritis FA20 Phase 1 [1]
------------------------------------------------------------------------------------
3 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
AMG 108 DMMUS8X Rheumatoid arthritis FA20 Discontinued in Phase 2 [2]
FR-133605 DMXWL0N Arthritis FA20 Terminated [3]
MRL-953 DM4A92X Immune System disease 4A01-4B41 Terminated [4]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTT
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Rheumatoid arthritis FA20 Synovial tissue 3.43E-01 0.21 0.4
------------------------------------------------------------------------------------

References

1 WO patent application no. 2013,0077,63, Modulators of the nlrp3 inflammasome il-1ss pathway for the prevention and treatment of acne.
2 Clinical pipeline report, company report or official report of Amgen (2009).
3 Effect of FR133605, a novel cytokine suppressive agent, on bone and cartilage destruction in adjuvant arthritic rats. J Rheumatol. 1996 Oct;23(10):1778-83.
4 SDZ MRL 953, a lipid A analog as selective cytokine inducer. Prog Clin Biol Res. 1995;392:549-65.