Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT5TQ2W)

DTT Name Granulocyte colony-stimulating factor (CSF3)
Synonyms Pluripoietin; Lenograstim; G-CSF; CSF3
Gene Name CSF3
DTT Type
Successful target
 [1]
BioChemical Class
Cytokine: interleukin
UniProt ID
CSF3_HUMAN
TTD ID
T19615
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAA
LQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQG
LLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRR
AGGVLVASHLQSFLEVSYRVLRHLAQP
Function
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.
KEGG Pathway
Cytokine-cytokine receptor interaction (hsa04060 )
PI3K-Akt signaling pathway (hsa04151 )
Jak-STAT signaling pathway (hsa04630 )
Hematopoietic cell lineage (hsa04640 )
Malaria (hsa05144 )
Reactome Pathway
Interleukin-10 signaling (R-HSA-6783783 )
Signaling by CSF3 (G-CSF) (R-HSA-9674555 )
Inactivation of CSF3 (G-CSF) signaling (R-HSA-9705462 )
Other interleukin signaling (R-HSA-449836 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
3 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Efbemalenograstim DMDNJ18 Neutropenia 4B00.0 Approved [2]
Eflapegrastim DMACVEI Neutropenia 4B00.0 Approved [3]
Interleukin-3 DM1Y69Q Aplastic anemia 3A70 Approved [1]
------------------------------------------------------------------------------------
4 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Neugranin DMLRKJX Neutropenia 4B00.0 Preregistration [4]
DA-3031 DM6S4R2 Neutropenia 4B00.0 Phase 3 [5]
LA-EP2006 DMI3YLK Neutropenia 4B00.0 Phase 3 [6]
MK-4214 DMA25NO Neutropenia 4B00.0 Phase 3 [7]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTT
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Breast cancer 2C82 Breast tissue 2.45E-03 -0.03 -0.09
Shwachman-Diamond syndrome 3B64 Bone marrow 7.72E-01 -1.68E-03 -0.01
------------------------------------------------------------------------------------

References

1 Interleukin 3: from colony-stimulating factor to pluripotent immunoregulatory cytokine. Int J Immunopharmacol. 1992 Apr;14(3):421-30.
2 Clinical pipeline report, company report or official report of Generon (Shanghai) Corporation Ltd.
3 Company report (Sppirx)
4 Development and Characterization of a Novel Fusion Protein of a Mutated Granulocyte Colony-Stimulating Factor and Human Serum Albumin in Pichia pastoris. PLoS One. 2014; 9(12): e115840.
5 A randomized, multi-center, open-label, phase II study of once-per-cycle DA-3031, a biosimilar pegylated G-CSF, compared with daily filgrastim in patients receiving TAC chemotherapy for early-stage breast cancer.Invest New Drugs.2013 Oct;31(5):1300-6.
6 National Cancer Institute Drug Dictionary (drug id 724518).
7 DOI: 10.1038/nbt0710-636a