Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT63M7Q)
DTT Name | Melanoma-associated antigen 1 (MAGEA1) | ||||
---|---|---|---|---|---|
Synonyms | Melanomaassociated antigen 1; MAGE1A; MAGE1 antigen; MAGE1; MAGE-1 antigen; Cancer/testis antigen 1.1; CT1.1; Antigen MZ2E; Antigen MZ2-E | ||||
Gene Name | MAGEA1 | ||||
DTT Type |
Clinical trial target
|
[1] | |||
BioChemical Class |
Melanoma associated antigen
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQG
ASAFPTTINFTRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAR EPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYD GLLGDNQIMPKTGFLIIVLVMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLT QDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVLEYVIKVSARVRFFFPSLREA ALREEEEGV |
||||
Function |
May inhibit notch intracellular domain (NICD) transactivation. May play a role in embryonal development and tumor transformation or aspects of tumor progression. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes. May be involved in transcriptional regulation through interaction with SNW1 and recruiting histone deactelyase HDAC1.
|
||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
1 Discontinued Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||