Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT6804T)

• DTT Name: MIF messenger RNA (MIF mRNA)
• Synonyms: Phenylpyruvate tautomerase (mRNA); MMIF (mRNA); L-dopachrome tautomerase (mRNA); L-dopachrome isomerase (mRNA); Glycosylation-inhibiting factor (mRNA); GLIF (mRNA); GIF (mRNA)
• Gene Name: MIF
• DTT Type: Literature-reported target; [1]
• BioChemical Class: mRNA target
• UniProt ID: MIF_HUMAN
• TTD ID: T78393
• EC Number: EC 5.3.2.1
• Sequence:
  MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
  SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
• Function: Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity. Pro-inflammatory cytokine.
• KEGG Pathway:
  Tyrosine metabolism (hsa00350)
  Phenylalanine metabolism (hsa00360)
• Reactome Pathway:
  Neutrophil degranulation (R-HSA-6798695)
  Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation (R-HSA-8950505)
  Cell surface interactions at the vascular wall (R-HSA-202733)

Molecular Interaction Atlas (MIA) of This DTT

28 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
1-(2-chlorophenyl)-3-(pyridin-2-yl)thiourea	DMGSKAO	Discovery agent	N.A.	Investigative	[2]
1-phenyl-3-(1,3,4-thiadiazol-2-yl)thiourea	DM6QU5B	Discovery agent	N.A.	Investigative	[2]
2-(4-hydroxystyryl)quinolin-8-ol	DM8GBH4	Discovery agent	N.A.	Investigative	[3]
3,3,3-tris(4-chlorophenyl)propanoic acid	DMBFY4H	Discovery agent	N.A.	Investigative	[4]
3-(1H-pyrazol-3-yl)benzoic acid	DMKFGDI	Discovery agent	N.A.	Investigative	[3]
3-acetyl-7-hydroxy-2H-chromen-2-one	DM01WBD	Discovery agent	N.A.	Investigative	[3]
3-benzyl-5-fluorobenzo[d]oxazol-2(3H)-one	DMZ85NC	Discovery agent	N.A.	Investigative	[5]
3-benzyl-5-methylbenzo[d]oxazol-2(3H)-one	DMHYQ3Z	Discovery agent	N.A.	Investigative	[5]
3-benzyl-6-methylbenzo[d]oxazol-2(3H)-one	DMGPKIY	Discovery agent	N.A.	Investigative	[5]
4-((pyridin-4-ylthio)methyl)benzene-1,2-diol	DM7X2AY	Discovery agent	N.A.	Investigative	[4]
4-(4-benzyl-1H-1,2,3-triazol-1-yl)phenol	DMT2S9U	Discovery agent	N.A.	Investigative	[6]
4-iodo-6-phenylpyrimidine	DMYNVLZ	Solid tumour/cancer	2A00-2F9Z	Investigative	[5]
6-phenylpyridazin-3-yl thiophene-2-carboxylate	DMXTV1B	Discovery agent	N.A.	Investigative	[2]
7-hydroxy-3-phenyl-2H-chromen-2-one	DM2ZE8U	Discovery agent	N.A.	Investigative	[3]
Benzofuran-2-yl(indolin-1-yl)methanone	DMF1ZE6	Discovery agent	N.A.	Investigative	[3]
Ethyl 7-hydroxy-2-oxo-2H-chromene-3-carboxylate	DM7FPX8	Discovery agent	N.A.	Investigative	[3]
ISIS 112580	DMXHQSG	Discovery agent	N.A.	Investigative	[1]
ISIS 112590	DMU5QRX	Discovery agent	N.A.	Investigative	[1]
ISIS 112592	DM9OPJW	Discovery agent	N.A.	Investigative	[1]
ISIS 112599	DMIYCMF	Discovery agent	N.A.	Investigative	[1]
ISIS 112690	DM6PO0N	Discovery agent	N.A.	Investigative	[1]
ISIS 112694	DMA4635	Discovery agent	N.A.	Investigative	[1]
ISIS 112696	DMXZS4Y	Discovery agent	N.A.	Investigative	[1]
ISIS 112699	DMIE0GJ	Discovery agent	N.A.	Investigative	[1]
ISIS 112711	DM52UGS	Discovery agent	N.A.	Investigative	[1]
ISIS 112724	DMB2O1Y	Discovery agent	N.A.	Investigative	[1]
N-(2-bromobenzoyloxy)-4-chlorobenzamide	DMFC564	Discovery agent	N.A.	Investigative	[2]
S-benzo[d]oxazol-2-yl O-butyl carbonothioate	DMCRQ29	Discovery agent	N.A.	Investigative	[2]

References

• [1] US patent application no. 6,268,151, Antisense modulation of macrophage migration inhibitory factor expression.
• [2] An integrative in silico methodology for the identification of modulators of macrophage migration inhibitory factor (MIF) tautomerase activity. Bioorg Med Chem. 2010 Jul 15;18(14):5425-40.
• [3] Discovery of human macrophage migration inhibitory factor (MIF)-CD74 antagonists via virtual screening. J Med Chem. 2009 Jan 22;52(2):416-24.
• [4] Classification of chemical compounds by protein-compound docking for use in designing a focused library. J Med Chem. 2006 Jan 26;49(2):523-33.
• [5] Optimization of N-benzyl-benzoxazol-2-ones as receptor antagonists of macrophage migration inhibitory factor (MIF). Bioorg Med Chem Lett. 2010 Oct 1;20(19):5811-4.
• [6] Receptor agonists of macrophage migration inhibitory factor. Bioorg Med Chem Lett. 2010 Dec 1;20(23):7033-6.