Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT6PKBX)

• DTT Name: Claudin-18 (CLDN18)
• Synonyms: UNQ778/PRO1572; Claudin18
• Gene Name: CLDN18
• DTT Type: Clinical trial target; [1]
• UniProt ID: CLD18_HUMAN
• TTD ID: T65883
• Sequence:
  MSTTTCQVVAFLLSILGLAGCIAATGMDMWSTQDLYDNPVTSVFQYEGLWRSCVRQSSGF
  TECRPYFTILGLPAMLQAVRALMIVGIVLGAIGLLVSIFALKCIRIGSMEDSAKANMTLT
  SGIMFIVSGLCAIAGVSVFANMLVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWV
  AGGLTLIGGVMMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKI
  YDGGARTEDEVQSYPSKHDYV
• Function: Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
• KEGG Pathway:
  Cell adhesion molecules (CAMs) (hsa04514)
  Tight junction (hsa04530)
  Leukocyte transendothelial migration (hsa04670)
  Hepatitis C (hsa05160)
• Reactome Pathway: Tight junction interactions (R-HSA-420029)

Molecular Interaction Atlas (MIA) of This DTT

9 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Claudiximab	DMPQR1D	Gastric adenocarcinoma	2B72	Phase 3	[1]
Zolbetuximab	DM5ST9Z	Esophagogastric junction neoplasm	2B71	Phase 3	[2]
CT-041	DM5XX06	Gastric cancer	2B72	Phase 1/2	[3]
RC118	DMU25QT	Aggressive cancer	2A00-2F9Z	Phase 1/2	[4]
AMG 910	DMCG7XL	Esophagogastric junction neoplasm	2B71	Phase 1	[5]
ASP2138	DM96QLF	Stomach cancer	2B72	Phase 1	[6]
SKB315	DMI0JT4	Aggressive cancer	2A00-2F9Z	Phase 1	[7]
TST001	DMZ9EMO	Solid tumour/cancer	2A00-2F9Z	Phase 1	[8]
CAR-CLD18 T cell	DM6ZHTV	Adenocarcinoma	2D40	Clinical trial	[9]

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
BNT212	DM27NTT	Aggressive cancer	2A00-2F9Z	Preclinical	[10]

References

• [1] Claudin 18.2 is a target for IMAB362 antibody in pancreatic neoplasms. Int J Cancer. 2014 Feb 1;134(3):731-9.
• [2] FAST: a randomised phase II study of zolbetuximab (IMAB362) plus EOX versus EOX alone for first-line treatment of advanced CLDN18.2-positive gastric and gastro-oesophageal adenocarcinoma. Ann Oncol. 2021 May;32(5):609-619.
• [3] Clinical pipeline report, company report or official report of CARSGEN
• [4] ClinicalTrials.gov (NCT05205850) An Open, Multi-center Phase I/IIa Clinical Study of RC118 for Injection in Patients With Locally Advanced Unresectable or Metastatic Malignant Solid Tumors With Positive Expression of Claudin 18.2. U.S.National Institutes of Health.
• [5] Clinical pipeline report, company report or official report of Amgen.
• [6] ClinicalTrials.gov (NCT05365581) A Phase 1/1b Study of ASP2138 in Participants With Metastatic or Locally Advanced Unresectable Gastric or Gastroesophageal Junction (GEJ) Adenocarcinoma or Metastatic Pancreatic Adenocarcinoma Whose Tumors Have Claudin (CLDN) 18.2 Expression. U.S.National Institutes of Health.
• [7] Clinical pipeline report, company report or official report of Klus Pharma
• [8] Clinical pipeline report, company report or official report of Transcenta.
• [9] ClinicalTrials.gov (NCT03302403) Clinical Study of Redirected Autologous T Cells With a Chimeric Antigen Receptor in Patients With Malignant Tumors
• [10] Clinical pipeline report, company report or official report of Biontech