Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT7Y3EJ)

DTT Name	D-amino acid oxidase (DAO)
Synonyms	Daminoacid oxidase; DAMOX; DAAO
Gene Name	DAO
DTT Type	Clinical trial target	[1]
BioChemical Class	CH-NH(2) donor oxidoreductase
UniProt ID	OXDA_HUMAN
TTD ID	T33124
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	EC 1.4.3.3
Sequence	MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPN NPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPR ELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGG IFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGP SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL
Function	Regulates the level of the neuromodulator D-serine in the brain. Has high activity towards D-DOPA and contributes to dopamine synthesis. Could act as a detoxifying agent which removes D-amino acids accumulated during aging. Acts on a variety of D-amino acids with a preference for those having small hydrophobic side chains followed by those bearing polar, aromatic, and basic groups. Does not act on acidic amino acids.
KEGG Pathway	Glycine, serine and threonine metabolism (hsa00260 ) Arginine and proline metabolism (hsa00330 ) D-Arginine and D-ornithine metabolism (hsa00472 ) Metabolic pathways (hsa01100 ) Biosynthesis of antibiotics (hsa01130 ) Peroxisome (hsa04146 )
Reactome Pathway	Peroxisomal protein import (R-HSA-9033241 ) Glyoxylate metabolism and glycine degradation (R-HSA-389661 )
BioCyc Pathway	MetaCyc:HS03351-MON

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
TAK-831	DMWPSJR	Friedreich's ataxia	8A03.10	Phase 2	[1]
------------------------------------------------------------------------------------

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
SEP-227900	DMXRU72	Cognitive impairment	6D71	Terminated	[2]
------------------------------------------------------------------------------------

The Drug-Metabolizing Enzyme (DME) Role of This DTT

DTT DME Name

D-amino-acid oxidase (DAO) DME Info

Gene Name

DAO

1 Approved Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
D-Serine	DM3YH4I	N. A.	N. A.	Phase 4	[3]
------------------------------------------------------------------------------------

References

1	Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
2	The Therapeutic Potential of D-Amino Acid Oxidase (DAAO) Inhibitors. Open Med Chem J. 2010; 4: 3-9.
3	Focus on the role of D-serine and D-amino acid oxidase in amyotrophic lateral sclerosis/motor neuron disease (ALS). Front Mol Biosci. 2018 Feb 13;5:8.