Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT8MK59)

• DTT Name: Melanocytes lineage-specific antigen GP100 (PMEL)
• Synonyms: Silver locus protein homolog; SILV; Premelanosome protein; PMEL17; P100; P1; Melanomaassociated ME20 antigen; Melanoma-associated ME20 antigen; Melanocyte protein Pmel 17; Melanocyte protein PMEL; Mbeta; ME20S; ME20M; ME20-M; D12S53E
• Gene Name: PMEL
• DTT Type: Clinical trial target; [1]
• Related Disease: Melanoma [ICD-11: 2C30]
• UniProt ID: PMEL_HUMAN
• TTD ID: T46128
• Sequence:
  MDLVLKRCLLHLAVIGALLAVGATKVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLDC
  WRGGQVSLKVSNDGPTLIGANASFSIALNFPGSQKVLPDGQVIWVNNTIINGSQVWGGQP
  VYPQETDDACIFPDGGPCPSGSWSQKRSFVYVWKTWGQYWQVLGGPVSGLSIGTGRAMLG
  THTMEVTVYHRRGSRSYVPLAHSSSAFTITDQVPFSVSVSQLRALDGGNKHFLRNQPLTF
  ALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTYLEPGPVTAQVVLQAAIPLTS
  CGSSPVPGTTDGHRPTAEAPNTTAGQVPTTEVVGTTPGQAPTAEPSGTTSVQVPTTEVIS
  TAPVQMPTAESTGMTPEKVPVSEVMGTTLAEMSTPEATGMTPAEVSIVVLSGTTAAQVTT
  TEWVETTARELPIPEPEGPDASSIMSTESITGSLGPLLDGTATLRLVKRQVPLDCVLYRY
  GSFSVTLDIVQGIESAEILQAVPSGEGDAFELTVSCQGGLPKEACMEISSPGCQPPAQRL
  CQPVLPSPACQLVLHQILKGGSGTYCLNVSLADTNSLAVVSTQLIMPGQEAGLGQVPLIV
  GILLVLMAVVLASLIYRRRLMKQDFSVPQLPHSSSHWLRLPRIFCSCPIGENSPLLSGQQ
  V
• Function: Involved in the maturation of melanosomes from stage I to II. The transition from stage I melanosomes to stage II melanosomes involves an elongation of the vesicle, and the appearance within of distinct fibrillar structures. Release of the soluble form, ME20-S, could protect tumor cells from antibody mediated immunity. Plays a central role in the biogenesis of melanosomes.

Molecular Interaction Atlas (MIA) of This DTT

6 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Melanoma vaccine	DMQEC6Z	Melanoma	2C30	Phase 3	[1]
Multi-epitope peptide melanoma vaccine	DMZPEHY	Melanoma	2C30	Phase 3	[2]
Gp100:209-217(210M) peptide vaccine	DM38ARE	Melanoma	2C30	Phase 2	[3]
IMCgp100	DMUJ1WV	Cutaneous melanoma	2C30	Phase 2	[4]
Multi-epitope tyrosinase/gp100 vaccine	DMN68ZL	Melanoma	2C30	Phase 2	[5]
AE-08	DM7X2HK	Melanoma	2C30	Phase 1	[6]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Melanoma vaccine (ALVAC)	DM3HIQY	Melanoma	2C30	Discontinued in Phase 2	[7]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Melanoma	2C82	Skin	1.08E-03	1.89	1.06

References

• [1] National Cancer Institute Drug Dictionary (drug id 685201).
• [2] Safety and immunogenicity of vaccination with MART-1 (26-35, 27L), gp100 (209-217, 210M), and tyrosinase (368-376, 370D) in-adjuvant with PF-3512676 and GM-CSF in metastatic melanoma. Correction in: volume 35 on page 650.
• [3] National Cancer Institute Drug Dictionary (drug id 476335).
• [4] Bi-specific TCR-anti CD3 redirected T-cell targeting of NY-ESO-1- and LAGE-1-positive tumors
• [5] ClinicalTrials.gov (NCT00003362) Vaccine Therapy Plus Immune Adjuvants in Treating Patients With Advanced Melanoma. U.S. National Institutes of Health.
• [6] Synthesis of labeled BCX-4208, a potent inhibitor of purine nucleoside phosphorylase. Drug Test Anal. 2009 Mar;1(3):125-7.
• [7] Preclinical qualification of a new multi-antigen candidate vaccine for metastatic melanoma. J Immunother. 2010 Oct;33(8):743-58.