Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT9MNE2)

DTT Name	Aldosterone synthase (CYP11B2)
Synonyms	Steroid 18hydroxylase; Cytochrome P450C18; Cytochrome P450Aldo; Cytochrome P450 11B2, mitochondrial; CYPXIB2; CYP11B2; Aldosteronesynthesizing enzyme; ALDOS
Gene Name	CYP11B2
DTT Type	Literature-reported target	[1]
BioChemical Class	Paired donor oxygen oxidoreductase
UniProt ID	C11B2_HUMAN
TTD ID	T59056
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	EC 1.14.15.4
Sequence	MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQG YEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYR QHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNA RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM PRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELS LEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATT ELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRP ERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQED IKMVYSFILRPGTSPLLTFRAIN
Function	Preferentially catalyzes the conversion of 11- deoxycorticosterone to aldosterone via corticosterone and 18- hydroxycorticosterone.
KEGG Pathway	Steroid hormone biosynthesis (hsa00140 ) Metabolic pathways (hsa01100 )
Reactome Pathway	Endogenous sterols (R-HSA-211976 ) Glucocorticoid biosynthesis (R-HSA-194002 )
BioCyc Pathway	MetaCyc:HS11355-MON

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Baxdrostat	DM7A4QE	Hypertension	BA00-BA04	Phase 2	[2]
MLS-101	DMCP2BJ	Hypertension	BA00-BA04	Phase 2	[3]
------------------------------------------------------------------------------------

The Drug-Metabolizing Enzyme (DME) Role of This DTT

DTT DME Name

Aldosterone synthase (CYP11B2) DME Info

Gene Name

CYP11B2

2 Approved Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Aldosterone	DM9S2JW	Hypertension	BA00-BA04	Approved	[4]
Hydrocortisone	DMGEMB7	Acne vulgaris	ED80	Approved	[5]
------------------------------------------------------------------------------------

1 Investigative Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
deoxycorticosterone	DMW6YLS	Discovery agent	N.A.	Investigative	[6]
------------------------------------------------------------------------------------

References

1	Medical management of Cushing's disease: what is the future . Pituitary. 2012 September; 15(3): 330-341.
2	Phase 2 Trial of Baxdrostat for Treatment-Resistant Hypertension. N Engl J Med. 2023 Feb 2;388(5):395-405.
3	ClinicalTrials.gov (NCT05001945) A Randomized, Double-blind, Placebo-controlled, Dose-ranging, Multicenter Phase 2 Study to Evaluate the Safety, Efficacy, and Tolerability of MLS-101 in Subjects With Uncontrolled Hypertension. U.S.National Institutes of Health.
4	Heteroaryl-substituted naphthalenes and structurally modified derivatives: selective inhibitors of CYP11B2 for the treatment of congestive heart failure and myocardial fibrosis. J Med Chem. 2005 Oct 20;48(21):6632-42.
5	Studies on the origin of circulating 18-hydroxycortisol and 18-oxocortisol in normal human subjects. J Clin Endocrinol Metab. 2004 Sep;89(9):4628-33.
6	Functional expression of human mitochondrial CYP11B2 in fission yeast and identification of a new internal electron transfer protein, etp1. Biochemistry. 2002 Feb 19;41(7):2311-21.