Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTALN9W)

• DTT Name: Indoleamine 2,3-dioxygenase 2 (IDO2)
• Synonyms: Indoleamine-pyrrole 2,3-dioxygenase-like protein 1; Indoleamine 2,3-dioxygenase-like protein 1; INDOL1; IDO-2
• Gene Name: IDO2
• DTT Type: Patented-recorded target; [1]
• BioChemical Class: Oxygenase
• UniProt ID: I23O2_HUMAN
• TTD ID: T62266
• EC Number: EC 1.13.11.-
• Sequence:
  MLHFHYYDTSNKIMEPHRPNVKTAVPLSLESYHISEEYGFLLPDSLKELPDHYRPWMEIA
  NKLPQLIDAHQLQAHVDKMPLLSCQFLKGHREQRLAHLVLSFLTMGYVWQEGEAQPAEVL
  PRNLALPFVEVSRNLGLPPILVHSDLVLTNWTKKDPDGFLEIGNLETIISFPGGESLHGF
  ILVTALVEKEAVPGIKALVQATNAILQPNQEALLQALQRLRLSIQDITKTLGQMHDYVDP
  DIFYAGIRIFLSGWKDNPAMPAGLMYEGVSQEPLKYSGGSAAQSTVLHAFDEFLGIRHSK
  ESGDFLYRMRDYMPPSHKAFIEDIHSAPSLRDYILSSGQDHLLTAYNQCVQALAELRSYH
  ITMVTKYLITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILHPRG
• Function: Involved in immune regulation. May not play a significant role in tryptophan-related tumoral resistance. Catalyzes the first and rate limiting step of the catabolism of the essential amino acid tryptophan along the kynurenine pathway.
• KEGG Pathway:
  Tryptophan metabolism (hsa00380)
  Metabolic pathways (hsa01100)
  African trypanosomiasis (hsa05143)
• Reactome Pathway: Tryptophan catabolism (R-HSA-71240)

Molecular Interaction Atlas (MIA) of This DTT

8 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
2,3-diamino-benzo[b]thiophene derivative 1	DMD2KRW	N. A.	N. A.	Patented	[1]
2,3-diamino-benzo[b]thiophene derivative 2	DMDYXKT	N. A.	N. A.	Patented	[1]
2,3-diamino-benzo[b]thiophene derivative 4	DMEDFNC	N. A.	N. A.	Patented	[1]
2,3-diamino-benzo[b]thiophene derivative 5	DM05WXD	N. A.	N. A.	Patented	[1]
2,3-diamino-benzo[b]thiophene derivative 6	DMINE6V	N. A.	N. A.	Patented	[1]
2,3-diamino-benzo[b]thiophene derivative 7	DMQVMNJ	N. A.	N. A.	Patented	[1]
2,3-diamino-benzo[b]thiophene derivative 8	DM5O8K0	N. A.	N. A.	Patented	[1]
PMID27172114-Compound-30	DMBWLSA	N. A.	N. A.	Patented	[1]

The Drug-Metabolizing Enzyme (DME) Role of This DTT

• DTT DME Name: Indoleamine 2,3-dioxygenase 2 (IDO2) DME Info
• Gene Name: IDO2

1 Approved Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
L-Tryptophan	DMIBH7M	Depression	6A70-6A7Z	Approved	[2]

References

• [1] Inhibitors of the kynurenine pathway as neurotherapeutics: a patent review (2012-2015).Expert Opin Ther Pat. 2016 Jul;26(7):815-32.
• [2] Kynurenine pathway metabolites and enzymes involved in redox reactions. Neuropharmacology. 2017 Jan;112(Pt B):331-345.