General Information of Drug Therapeutic Target (DTT) (ID: TTAVUMS)

DTT Name HUMAN toll-like receptor 2 (TLR2)
Synonyms Toll/interleukin-1 receptor-like protein 4; TIL4; CD282
Gene Name TLR2
BioChemical Class
Toll-like receptor
UniProt ID
TLR2_HUMAN
TTD ID
T89083
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLS
NNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWF
KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELE
IDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFS
ELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN
DRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLK
SLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDI
SKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLK
ELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCE
FLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFL
LILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMV
QELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFS
HFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRA
AIKS
Function
Cooperates with TLR1 or TLR6 to mediate the innate immune response to bacterial lipoproteins or lipopeptides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. May also activate immune cells and promote apoptosis in response to the lipid moiety of lipoproteins. Recognizes mycoplasmal macrophage-activating lipopeptide-2kD (MALP-2), soluble tuberculosis factor (STF), phenol-soluble modulin (PSM) and B. burgdorferi outer surface protein A lipoprotein (OspA-L) cooperatively with TLR6. Stimulation of monocytes in vitro with M. tuberculosis PstS1 induces p38 MAPK and ERK1/2 activation primarily via this receptor, but also partially via TLR4. MAPK activation in response to bacterial peptidoglycan also occurs via this receptor. Acts as a receptor for M. tuberculosis lipoproteins LprA, LprG, LpqH and PstS1, some lipoproteins are dependent on other coreceptors (TLR1, CD14 and/or CD36); the lipoproteins act as agonists to modulate antigen presenting cell functions in response to the pathogen. M. tuberculosis HSP70 (dnaK) but not HSP65 (groEL-2) acts via this protein to stimulate NF-kappa-B expression. Recognizes M. tuberculosis major T-antigen EsxA (ESAT-6) which inhibits downstream MYD88-dependent signaling (shown in mouse). Forms activation clusters composed of several receptors depending on the ligand, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway. Forms the cluster TLR2:TLR6:CD14:CD36 in response to diacylated lipopeptides and TLR2:TLR1:CD14 in response to triacylated lipopeptides. Required for normal uptake of M. tuberculosis, a process that is inhibited by M. tuberculosis LppM. Cooperates with LY96 to mediate the innate immune response to bacterial lipoproteins and other microbial cell wall components.
KEGG Pathway
Phagosome (hsa04145 )
PI3K-Akt signaling pathway (hsa04151 )
Neutrophil extracellular trap formation (hsa04613 )
Toll-like receptor signaling pathway (hsa04620 )
Salmonella infection (hsa05132 )
Legionellosis (hsa05134 )
Leishmaniasis (hsa05140 )
Chagas disease (hsa05142 )
Malaria (hsa05144 )
Toxoplasmosis (hsa05145 )
Amoebiasis (hsa05146 )
Tuberculosis (hsa05152 )
Hepatitis B (hsa05161 )
Measles (hsa05162 )
Herpes simplex virus 1 infection (hsa05168 )
Epstein-Barr virus infection (hsa05169 )
Human immunodeficiency virus 1 infection (hsa05170 )
Coronavirus disease - COVID-19 (hsa05171 )
Proteoglycans in cancer (hsa05205 )
PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235 )
Inflammatory bowel disease (hsa05321 )
Rheumatoid arthritis (hsa05323 )
Lipid and atherosclerosis (hsa05417 )
Reactome Pathway
Beta defensins (R-HSA-1461957 )
MyD88 (R-HSA-166058 )
Toll Like Receptor TLR1 (R-HSA-168179 )
Toll Like Receptor TLR6 (R-HSA-168188 )
MyD88 deficiency (TLR2/4) (R-HSA-5602498 )
IRAK4 deficiency (TLR2/4) (R-HSA-5603041 )
Regulation of TLR by endogenous ligand (R-HSA-5686938 )
Neutrophil degranulation (R-HSA-6798695 )
Modulation by Mtb of host immune system (R-HSA-9637628 )
SARS-CoV-2 activates/modulates innate and adaptive immune responses (R-HSA-9705671 )
ER-Phagosome pathway (R-HSA-1236974 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
1 Drugs in Phase 2 Trial Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
PUL-042 DMW7L0Y Coronavirus Disease 2019 (COVID-19) 1D6Y Phase 2 Trial [1]
------------------------------------------------------------------------------------

References

1 Pulmotects lead product, PUL-042, is a clinical stage inhaled therapeutic that in preclinical studies stimulates the innate immune system in minutes to provide immediate and effective protection against all major classes of pathogens that lasts for days.