Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTBE4IR)

DTT Name	Plasmodium Oxoacyl-[acyl-carrier protein] reductase (Malaria fabG)
Synonyms	3-oxoacyl-acyl-carrier protein reductase
Gene Name	Malaria fabG
DTT Type	Clinical trial target	[1]
BioChemical Class	Short-chain dehydrogenases reductase
UniProt ID	Q965D6_PLAFA
TTD ID	T61317
EC Number	EC 1.1.1.100
Sequence	MSVLHRFYLFFLFTKFFHCYKISYVLKNAKLAPNHAIKNINSLNLLSENKKENYYYCGEN KVALVTGAGRGIGREIAKMLAKSVSHVICISRTQKSCDSVVDEIKSFGYESSGYAGDVSK KEEISEVINKILTEHKNVDILVSNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPIS KRMINNRYGRIINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPG FISSDMTDKISEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGGLS P
Function	Participates in fatty acid biosynthesis and polyunsaturated fatty acid biosynthesis. Catalyzes the NADPH-dependent reduction of beta-ketoacyl-ACP substrates to beta-hydroxyacyl-ACP products, the first reductive step in the elongation cycle of fatty acid biosynthesis.

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Epigallocatechin gallate	DMCGWBJ	Hepatic fibrosis	DB93.0	Phase 3	[1]
------------------------------------------------------------------------------------

9 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(-)-CATECHINGALLATE	DMZOGSK	Discovery agent	N.A.	Investigative	[1]
2-Hexadecynoic acid	DMTFIPZ	Discovery agent	N.A.	Investigative	[2]
3,7,3',4'-TETRAHYDROXYFLAVONE	DMES906	Discovery agent	N.A.	Investigative	[1]
Chrysin	DM7V2LG	Discovery agent	N.A.	Investigative	[1]
GALLOCATECHIN GALLATE	DMX2084	Discovery agent	N.A.	Investigative	[1]
ISORHAMNETIN	DMQ4Z6E	Discovery agent	N.A.	Investigative	[1]
KAEMPFEROL	DMHEMUB	Discovery agent	N.A.	Investigative	[1]
MORIN	DM2OGZ5	Discovery agent	N.A.	Investigative	[1]
NADPH	DM75Q34	Discovery agent	N.A.	Investigative	[3]
------------------------------------------------------------------------------------


⏷ Show the Full List of 9 Investigative Drug(s)

References

1	Inhibition of Plasmodium falciparum fatty acid biosynthesis: evaluation of FabG, FabZ, and FabI as drug targets for flavonoids. J Med Chem. 2006 Jun 1;49(11):3345-53.
2	2-Hexadecynoic acid inhibits plasmodial FAS-II enzymes and arrests erythrocytic and liver stage Plasmodium infections. Bioorg Med Chem. 2010 Nov 1;18(21):7475-85.
3	Functional characterization of beta-ketoacyl-ACP reductase (FabG) from Plasmodium falciparum. Biochem Biophys Res Commun. 2003 Mar 28;303(1):387-92.