Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTCYE56)

DTT Name	Glutathione-dependent PGD synthase (HPGDS)
Synonyms	HPGDS; Glutathione-S-transferase; GST class-alpha
Gene Name	HPGDS
DTT Type	Successful target	[1]
BioChemical Class	Intramolecular oxidoreductases
UniProt ID	HPGDS_HUMAN
TTD ID	T19433
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	EC 5.3.99.2
Sequence	MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK VQAIPAVANWIKRRPQTKL
Function	Bifunctional enzyme which catalyzes both the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation, and the conjugation of glutathione with a widerange of aryl halides and organic isothiocyanates. Also exhibits low glutathione-peroxidase activity towards cumene hydroperoxide.
KEGG Pathway	Arachidonic acid metabolism (hsa00590 ) Metabolic pathways (hsa01100 )
Reactome Pathway	Synthesis of Prostaglandins (PG) and Thromboxanes (TX) (R-HSA-2162123 ) Glutathione conjugation (R-HSA-156590 )
BioCyc Pathway	MetaCyc:HS08788-MON

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Praziquantel	DMOU1PK	Flatworm infection	1F70-1F86	Approved	[1]
------------------------------------------------------------------------------------

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
HF-0220	DMI4C90	Alzheimer disease	8A20	Phase 2	[2]
------------------------------------------------------------------------------------

5 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Cibacron blue	DMWE1N8	Discovery agent	N.A.	Investigative	[3]
Formic Acid	DMNFZC6	Discovery agent	N.A.	Investigative	[4]
HQL-79	DMSHYQ3	Discovery agent	N.A.	Investigative	[5]
Protoporphyrin IX	DMWYE7A	Discovery agent	N.A.	Investigative	[6]
S-hexylglutathione	DMNWP02	Discovery agent	N.A.	Investigative	[7]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Alzheimer's disease	8A00.0	Entorhinal cortex	1.63E-05	0.34	0.71
------------------------------------------------------------------------------------

References

1	X-ray structure of glutathione S-transferase from Schistosoma japonicum in a new crystal form reveals flexibility of the substrate-binding site. Acta Crystallogr Sect F Struct Biol Cryst Commun. 2005 Mar 1;61(Pt 3):263-5.
2	US patent application no. 2009,0062,529, Multi-cyclic compounds.
3	A novel method for screening the glutathione transferase inhibitors. BMC Biochem. 2009 Mar 16;10:6.
4	How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
5	Structural and functional characterization of HQL-79, an orally selective inhibitor of human hematopoietic prostaglandin D synthase. J Biol Chem. 2006 Jun 2;281(22):15277-86.
6	Inhibition of glutathione-S-transferase from Plasmodium yoelii by protoporphyrin IX, cibacron blue and menadione: implications and therapeutic bene... Parasitol Res. 2008 Mar;102(4):805-7.
7	Purification and catalytic properties of glutathione transferase from the hepatopancreas of crayfish macrobrachium vollenhovenii (herklots). J Biochem Mol Toxicol. 2004;18(6):332-44.