Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTDO1MV)

DTT Name	T-cell activation antigen CD27 (CD27)
Synonyms	Tumor necrosis factor receptor superfamily member 7; Tcell activation antigen CD27; TNFRSF7; T14; CD27L receptor; CD27 antigen
Gene Name	CD27
DTT Type	Clinical trial target	[1]
BioChemical Class	Cytokine receptor
UniProt ID	CD27_HUMAN
TTD ID	T85554
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAA QCDPCIPGVSFSPDHHTRPHCESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTEC DPLPNPSLTARSSQALSPHPQPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPP QRSLCSSDFIRILVIFSGMFLVFTLAGALFLHQRRKYRSNKGESPVEPAEPCHYSCPREE EGSTIPIQEDYRKPEPACSP
Function	May play a role in survival of activated T-cells. May play a role in apoptosis through association with SIVA1. Receptor for CD70/CD27L.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 )
Reactome Pathway	TNFs bind their physiological receptors (R-HSA-5669034 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

3 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Varlilumab	DMQSC5O	Colorectal cancer	2B91.Z	Phase 2	[1]
CDX-1127	DMPVUGE	leukaemia	2A60-2B33	Phase 1	[2]
CDX-527	DMVDIWO	Solid tumour/cancer	2A00-2F9Z	Phase 1	[3]
------------------------------------------------------------------------------------

References

1	Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
2	Clinical pipeline report, company report or official report of Celldex Therapeutics.
3	Development of CDX-527: a bispecific antibody combining PD-1 blockade and CD27 costimulation for cancer immunotherapy. Cancer Immunol Immunother. 2020 Oct;69(10):2125-2137.