Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTE5VP6)

• DTT Name: Inducible T-cell costimulator (ICOS)
• Synonyms: Inducible costimulator; Inducible T-cell co-stimulator; Inducible COSTIMULATOR precursor; CD278; Activation-inducible lymphocyte immunomediatory molecule; AILIM
• Gene Name: ICOS
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Immunoglobulin
• UniProt ID: ICOS_HUMAN
• TTD ID: T62705
• Sequence:
  MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQ
  ILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFK
  VTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEY
  MFMRAVNTAKKSRLTDVTL
• Function: Essential both for efficient interaction between T and B-cells and for normal antibody responses to T-cell dependent antigens. Does not up-regulate the production of interleukin-2, but superinduces the synthesis of interleukin-10. Prevents the apoptosis of pre-activated T-cells. Plays a critical role in CD40-mediated class switching of immunoglobin isotypes. Enhances all basic T-cell responses to a foreign antigen, namely proliferation, secretion of lymphokines, up-regulation of molecules that mediate cell-cell interaction, and effective help for antibody secretion by B-cells.
• KEGG Pathway:
  Cell adhesion molecules (CAMs) (hsa04514)
  T cell receptor signaling pathway (hsa04660)
  Intestinal immune network for IgA production (hsa04672)
  Primary immunodeficiency (hsa05340)
• Reactome Pathway:
  Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530)
  Costimulation by the CD28 family (R-HSA-388841)
  PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558)
  PIP3 activates AKT signaling (R-HSA-1257604)

Molecular Interaction Atlas (MIA) of This DTT

4 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
JTX-2011	DMGXTOP	Solid tumour/cancer	2A00-2F9Z	Phase 2	[1]
KY1044	DMXJ683	Solid tumour/cancer	2A00-2F9Z	Phase 1/2	[2]
MEDI-570	DMCJFLS	Systemic lupus erythematosus	4A40.0	Phase 1	[3]
XmAb23104	DMK9XUQ	Solid tumour/cancer	2A00-2F9Z	Phase 1	[4]

References

• [1] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [2] Clinical pipeline report, company report or official report of Kymab.
• [3] B-cell targeted therapeutics in clinical development. Arthritis Res Ther. 2013;15 Suppl 1:S4.
• [4] Clinical pipeline report, company report or official report of Xencor.