Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTE836A)

DTT Name	C-C chemokine receptor type 8 (CCR8)
Synonyms	TER1; GPRCY6; GPR-CY6; Chemokine receptor-like 1; Chemokine receptor CCR8; CMKBRL2; CMKBR8; CKRL1; CKR-L1; CDw198; CCR-8; CC-chemokine receptor CHEMR1; CC-CKR-8; CC chemokine receptor CHEMR1; C-C CKR-8
Gene Name	CCR8
DTT Type	Discontinued target	[1]
BioChemical Class	GPCR rhodopsin
UniProt ID	CCR8_HUMAN
TTD ID	T20575
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVL VVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSS MFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGV LQCYSFYNQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLV LIVVIASLLFWVPFNVVLFLTSLHSMHILDGCSISQQLTYATHVTEIISFTHCCVNPVIY AFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSSVDYIL
Function	May regulate monocyte chemotaxis and thymic cell line apoptosis. Alternative coreceptor with CD4 for HIV-1 infection. Receptor for the chemokine CCL1/SCYA1/I-309.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 ) Chemokine signaling pathway (hsa04062 ) Viral carcinogenesis (hsa05203 )
Reactome Pathway	G alpha (i) signalling events (R-HSA-418594 ) Chemokine receptors bind chemokines (R-HSA-380108 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
GS-1811	DMCEMC6	Solid tumour/cancer	2A00-2F9Z	Phase 1	[2]
------------------------------------------------------------------------------------

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CCX-832	DMD8QHV	Psoriasis vulgaris	EA90	Discontinued in Phase 1	[1]
------------------------------------------------------------------------------------

5 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
I-309	DM7QE51	Discovery agent	N.A.	Investigative	[3]
N-(4-phenylsulfamoyl-naphthalen-1-yl)-benzamide	DMQS9OH	Discovery agent	N.A.	Investigative	[4]
N-{4-[(benzylamino)sulfonyl]-1-naphthyl}benzamide	DM74KHG	Discovery agent	N.A.	Investigative	[4]
viral macrophage inflammatory protein-II	DMAXOPS	Discovery agent	N.A.	Investigative	[5]
ZK 756326	DMP089G	Discovery agent	N.A.	Investigative	[6]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Psoriasis	EA90	Skin	2.96E-02	0.07	0.25
------------------------------------------------------------------------------------

References

1	Increased Expression of Chemerin in Squamous Esophageal Cancer Myofibroblasts and Role in Recruitment of Mesenchymal Stromal Cells. PLoS One. 2014; 9(8): e104877.
2	Differential expression of CCR8 in tumors versus normal tissue allows specific depletion of tumor-infiltrating T regulatory cells by GS-1811, a novel Fc-optimized anti-CCR8 antibody. Oncoimmunology. 2022 Nov 4;11(1):2141007.
3	The chemokine receptor CCR8 is preferentially expressed in Th2 but not Th1 cells. J Immunol. 1998 Jul 15;161(2):547-51.
4	Design, synthesis, and evaluation of naphthalene-sulfonamide antagonists of human CCR8. J Med Chem. 2007 Feb 8;50(3):566-84.
5	HHV8-encoded vMIP-I selectively engages chemokine receptor CCR8. Agonist and antagonist profiles of viral chemokines. J Biol Chem. 1999 Jul 30;274(31):21569-74.
6	Identification and characterization of a potent, selective nonpeptide agonist of the CC chemokine receptor CCR8. Mol Pharmacol. 2006 Jan;69(1):309-16.