Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTFC29G)

• DTT Name: Glycoprotein hormones alpha (CGA)
• Synonyms: Thyrotropin alpha chain; Thyroid-stimulating hormone alpha chain; TSH-alpha; Lutropin alpha chain; Luteinizing hormone alpha chain; LSH-alpha; Glycoprotein hormones alpha chain; Follitropin alpha chain; Follicle-stimulating hormone alpha chain; FSH-alpha; Chorionic gonadotrophin subunit alpha; Choriogonadotropin alpha chain; CG-alpha; Anterior pituitary glycoprotein hormones common subunit alpha
• Gene Name: CGA
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Glycoprotein hormone
• UniProt ID: GLHA_HUMAN
• TTD ID: T16650
• Sequence:
  MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRA
  YPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
• Function: Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH, follitropin/follicle stimulating hormone/FSH and choriogonadotropin/CG. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.
• KEGG Pathway:
  Neuroactive ligand-receptor interaction (hsa04080)
  GnRH signaling pathway (hsa04912)
  Ovarian steroidogenesis (hsa04913)
  Prolactin signaling pathway (hsa04917)
  Thyroid hormone synthesis (hsa04918)
  Autoimmune thyroid disease (hsa05320)
• Reactome Pathway:
  Thyroxine biosynthesis (R-HSA-209968)
  Hormone ligand-binding receptors (R-HSA-375281)
  G alpha (s) signalling events (R-HSA-418555)
  Androgen biosynthesis (R-HSA-193048)

Molecular Interaction Atlas (MIA) of This DTT

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Alpha-D-Mannose	DMF5DLW	Discovery agent	N.A.	Investigative	[1]

References

• [1] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.