Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTG25NJ)
DTT Name | Vesicle-associated membrane protein (VAMP) | ||||
---|---|---|---|---|---|
Synonyms | VAMP; Synaptobrevin; SYB | ||||
Gene Name | VAMP1 | ||||
DTT Type |
Successful target
|
[1] | |||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQ
KLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT |
||||
Function | Involved in the targeting and/or fusion of transport vesicles to their target membrane. | ||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Approved Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||