Details of the Drug

General Information of Drug (ID: DM58QS1)

Drug Name

Botulinum Toxin Type B

Synonyms

BTXA (TN); Dysport (TN); Myobloc (TN); Neurobloc (TN); Xeomin (TN)

Indication

Disease Entry	ICD 11	Status	REF
Parkinson disease	8A00.0	Approved	[1]
------------------------------------------------------------------------------------

Therapeutic Class

Antidystonic Agents

Sequence

MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERYTFGYKPEDFN
KSSGIFNRDVCEYYDPDYLNTNDKKNIFLQTMIKLFNRIKSKPLGEKLLEMIINGIPYLG
DRRVPLEEFNTNIASVTVNKLISNPGEVERKKGIFANLIIFGPGPVLNENETIDIGIQNH
FASREGFGGIMQMKFCPEYVSVFNNVQENKGASIFNRRGYFSDPALILMHELIHVLHGLY
GIKVDDLPIVPNEKKFFMQSTDAIQAEELYTFGGQDPSIITPSTDKSIYDKVLQNFRGIV
DRLNKVLVCISDPNININIYKNKFKDKYKFVEDSEGKYSIDVESFDKLYKSLMFGFTETN
IAENYKIKTRASYFSDSLPPVKIKNLLDNEIYTIEEGFNISDKDMEKEYRGQNKAINKQA
YEEISKEHLAVYKIQMCKSVKAPGICIDVDNEDLFFIADKNSFSDDLSKNERIEYNTQSN
YIENDFPINELILDTDLISKIELPSENTESLTDFNVDVPVYEKQPAIKKIFTDENTIFQY
LYSQTFPLDIRDISLTSSFDDALLFSNKVYSFFSMDYIKTANKVVEAGLFAGWVKQIVND
FVIEANKSNTMDKIADISLIVPYIGLALNVGNETAKGNFENAFEIAGASILLEFIPELLI
PVVGAFLLESYIDNKNKIIKTIDNALTKRNEKWSDMYGLIVAQWLSTVNTQFYTIKEGMY
KALNYQAQALEEIIKYRYNIYSEKEKSNINIDFNDINSKLNEGINQAIDNINNFINGCSV
SYLMKKMIPLAVEKLLDFDNTLKKNLLNYIDENKLYLIGSAEYEKSKVNKYLKTIMPFDL
SIYTNDTILIEMFNKYNSEILNNIILNLRYKDNNLIDLSGYGAKVEVYDGVELNDKNQFK
LTSSANSKIRVTQNQNIIFNSVFLDFSVSFWIRIPKYKNDGIQNYIHNEYTIINCMKNNS
GWKISIRGNRIIWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTITNNLNNAKIYING
KLESNTDIKDIREVIANGEIIFKLDGDIDRTQFIWMKYFSIFNTELSQSNIEERYKIQSY
SEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKLKKDSPVGEILTRSKYNQNSKYINYRDLY
IGEKFIIRRKSNSQSINDDIVRKEDYIYLDFFNLNQEWRVYTYKYFKKEEEKLFLAPISD
SDEFYNTIQIKEYDEQPTYSCQLLFKKDEESTDEIGLIGIHRFYESGIVFEEYKDYFCIS
KWYLKEVKRKPYNLKLGCNWQFIPKDEGWTE

Cross-matching ID

DrugBank ID: DB00042
TTD ID: D02FXK

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Vesicle-associated membrane protein (VAMP)	TTG25NJ	VAMP1_HUMAN ; VAMP2_HUMAN	Binder	[2]

------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Botulinum Toxin Type B

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Disease	REF
Biperiden	DME78OA	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Biperiden.	Parkinsonism [8A00]	[3]
Benztropine	DMGZOVN	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Benztropine.	Parkinsonism [8A00]	[3]
Procyclidine	DMHFJDT	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Procyclidine.	Parkinsonism [8A00]	[3]
-----------

Coadministration of a Drug Treating the Disease Different from Botulinum Toxin Type B (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Scopolamine	DMOM8AL	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Scopolamine.	Addictive disorder [6C50-6C5Z]	[3]
Mepyramine	DMB4SFH	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Mepyramine.	Allergic/hypersensitivity disorder [4A80-4A8Z]	[3]
Phenyltoloxamine	DMKAEQW	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Phenyltoloxamine.	Allergic/hypersensitivity disorder [4A80-4A8Z]	[3]
Tripelennamine	DMZBU15	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Tripelennamine.	Allergic/hypersensitivity disorder [4A80-4A8Z]	[3]
Hydroxyzine	DMF8Y74	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Hydroxyzine.	Anxiety disorder [6B00-6B0Z]	[3]
Promazine	DMZAL7W	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Promazine.	Appearance/behaviour symptom [MB23]	[3]
Desipramine	DMT2FDC	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Desipramine.	Attention deficit hyperactivity disorder [6A05]	[3]
Imipramine	DM2NUH3	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Imipramine.	Depression [6A70-6A7Z]	[3]
Nortriptyline	DM4KDYJ	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Nortriptyline.	Depression [6A70-6A7Z]	[3]
Clomipramine	DMINRKW	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Clomipramine.	Depression [6A70-6A7Z]	[3]
Amitriptyline	DMK7F9S	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Amitriptyline.	Depression [6A70-6A7Z]	[3]
Amoxapine	DMKITQE	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Amoxapine.	Depression [6A70-6A7Z]	[3]
Protriptyline	DMNHTZI	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Protriptyline.	Depression [6A70-6A7Z]	[3]
Doxepin	DMPI98T	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Doxepin.	Depression [6A70-6A7Z]	[3]
Maprotiline	DMPWB7T	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Maprotiline.	Depression [6A70-6A7Z]	[3]
Hyoscyamine	DM804UR	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Hyoscyamine.	Digestive system disease [DE2Z]	[3]
Mepenzolate	DM8YU2F	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Mepenzolate.	Digestive system disease [DE2Z]	[3]
Oxybutynine	DMJPBAX	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Oxybutynine.	Discovery agent [N.A.]	[3]
Meclizine	DMS7T13	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Meclizine.	Dizziness and giddiness [MB48]	[3]
Trihexyphenidyl	DMB19L8	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Trihexyphenidyl.	Dystonic disorder [8A02]	[3]
Diphenhydramine	DMKQTBA	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Diphenhydramine.	Episodic vestibular syndrome [AB31]	[3]
Solifenacin	DMG592Q	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Solifenacin.	Functional bladder disorder [GC50]	[3]
Tolterodine	DMSHPW8	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Tolterodine.	Functional bladder disorder [GC50]	[3]
Darifenacin	DMWXLYZ	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Darifenacin.	Functional bladder disorder [GC50]	[3]
Propantheline	DM2EN6G	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Propantheline.	Gastric ulcer [DA60]	[3]
Propiomazine	DMKY8V1	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Propiomazine.	Insomnia [7A00-7A0Z]	[3]
Clidinium	DMUMQZ0	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Clidinium.	Irritable bowel syndrome [DD91]	[3]
Dicyclomine	DMZSDGX	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Dicyclomine.	Irritable bowel syndrome [DD91]	[3]
Doxylamine	DMKOXFE	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Doxylamine.	Morning sickness disorder [SC00]	[3]
Phenindamine	DMDTC7R	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Phenindamine.	Nasopharyngitis [CA00]	[3]
Dimenhydrinate	DM264B3	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Dimenhydrinate.	Nausea/vomiting [MD90]	[3]
Prochlorperazine	DM53SRA	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Prochlorperazine.	Nausea/vomiting [MD90]	[3]
Promethazine	DM6I5GR	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Promethazine.	Nausea/vomiting [MD90]	[3]
Cyclizine	DM9G7BS	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Cyclizine.	Nausea/vomiting [MD90]	[3]
Thiethylperazine	DMU3IET	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Thiethylperazine.	Nausea/vomiting [MD90]	[3]
Flavoxate	DMKV4NL	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Flavoxate.	Pain [MG30-MG3Z]	[3]
Methylscopolamine	DM5VWOB	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Methylscopolamine.	Peptic ulcer [DA61]	[3]
Levomepromazine	DMIKFEL	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Levomepromazine.	Psychotic disorder [6A20-6A25]	[3]
Fluphenazine	DMIT8LX	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Fluphenazine.	Psychotic disorder [6A20-6A25]	[3]
Triflupromazine	DMKFQJP	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Triflupromazine.	Psychotic disorder [6A20-6A25]	[3]
Cyproheptadine	DM92AH3	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Cyproheptadine.	Rheumatoid arthritis [FA20]	[3]
Mesoridazine	DM2ZGAN	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Mesoridazine.	Schizophrenia [6A20]	[3]
Thioridazine	DM35M8J	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Thioridazine.	Schizophrenia [6A20]	[3]
Loxapine	DM8AI9U	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Loxapine.	Schizophrenia [6A20]	[3]
Perphenazine	DMA4MRX	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Perphenazine.	Schizophrenia [6A20]	[3]
Molindone	DMAH70G	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Molindone.	Schizophrenia [6A20]	[3]
Chlorpromazine	DMBGZI3	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Chlorpromazine.	Schizophrenia [6A20]	[3]
Thiothixene	DMDINC4	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Thiothixene.	Schizophrenia [6A20]	[3]
Clozapine	DMFC71L	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Clozapine.	Schizophrenia [6A20]	[3]
Trifluoperazine	DMKBYWI	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Trifluoperazine.	Schizophrenia [6A20]	[3]
Pimozide	DMW83TP	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Pimozide.	Schizophrenia [6A20]	[3]
Trospium	DMX6RTG	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Trospium.	Tonus and reflex abnormality [MB47]	[3]
Chlorpheniramine	DM5URA2	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Chlorpheniramine.	Vasomotor/allergic rhinitis [CA08]	[3]
Triprolidine	DM7SWIA	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Triprolidine.	Vasomotor/allergic rhinitis [CA08]	[3]
Methdilazine	DMAUHQX	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Methdilazine.	Vasomotor/allergic rhinitis [CA08]	[3]
Clemastine	DMBZWQL	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Clemastine.	Vasomotor/allergic rhinitis [CA08]	[3]
Carbinoxamine	DMCT31R	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Carbinoxamine.	Vasomotor/allergic rhinitis [CA08]	[3]
Trimeprazine	DMEMV9D	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Trimeprazine.	Vasomotor/allergic rhinitis [CA08]	[3]
Brompheniramine	DMFOVSD	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Brompheniramine.	Vasomotor/allergic rhinitis [CA08]	[3]
Dexbrompheniramine	DMKVWGE	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Dexbrompheniramine.	Vasomotor/allergic rhinitis [CA08]	[3]
Acrivastine	DMTIGA0	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Acrivastine.	Vasomotor/allergic rhinitis [CA08]	[3]
Azatadine	DMZ80SB	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Azatadine.	Vasomotor/allergic rhinitis [CA08]	[3]
Disopyramide	DM5SYZP	Moderate	Additive anticholinergic effects by the combination of Botulinum Toxin Type B and Disopyramide.	Ventricular tachyarrhythmia [BC71]	[3]
-----------


⏷ Show the Full List of 63 DDI Information of This Drug

References

1	Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77.
2	Long-lasting benefits of botulinum toxin type B in Parkinson's disease-related drooling. J Neurol. 2009 Apr;256(4):563-7.
3	Product Information. Botox (onabotulinumtoxin A). Allergan Inc, Irvine, CA.