Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTHWMFZ)

DTT Name Fatty acid-binding protein 4 (FABP4)
Synonyms
Fatty acid-binding protein, adipocyte; Adipocyte-type fatty acid-binding protein; Adipocyte lipid-binding protein; Adipocyte fatty-acid-binding protein; Adipocyte fatty binding protein; ALBP; AFABP; A-FABP
Gene Name FABP4
DTT Type
Patented-recorded target
 [1]
BioChemical Class
Fatty acid binding protein
UniProt ID
FABP4_HUMAN
TTD ID
T07217
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
Function Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus. Lipid transport protein in adipocytes.
KEGG Pathway
PPAR signaling pathway (hsa03320 )
Reactome Pathway
Transcriptional regulation of white adipocyte differentiation (R-HSA-381340 )
Hormone-sensitive lipase (HSL)-mediated triacylglycerol hydrolysis (R-HSA-163560 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
25 Patented Agent(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
PMID27109571-Compound-10 DMW60HU N. A. N. A. Patented [1]
PMID27109571-Compound-11 DMMI4KQ N. A. N. A. Patented [1]
PMID27109571-Compound-12 DM6HWBK N. A. N. A. Patented [1]
PMID27109571-Compound-13 DMUKOGJ N. A. N. A. Patented [1]
PMID27109571-Compound-14 DMVY6B9 N. A. N. A. Patented [1]
PMID27109571-Compound-15 DMUR3FY N. A. N. A. Patented [1]
PMID27109571-Compound-16 DMZI25U N. A. N. A. Patented [1]
PMID27109571-Compound-17 DMBETU6 N. A. N. A. Patented [1]
PMID27109571-Compound-18 DM4S5ME N. A. N. A. Patented [1]
PMID27109571-Compound-19 DMIJGLB N. A. N. A. Patented [1]
PMID27109571-Compound-20 DMQU9XP N. A. N. A. Patented [1]
PMID27109571-Compound-21 DM0R5Y8 N. A. N. A. Patented [1]
PMID27109571-Compound-22 DMC52VP N. A. N. A. Patented [1]
PMID27109571-Compound-23 DML49UI N. A. N. A. Patented [1]
PMID27109571-Compound-24 DMPHTC0 N. A. N. A. Patented [1]
PMID27109571-Compound-25 DM435GR N. A. N. A. Patented [1]
PMID27109571-Compound-26 DMJCL53 N. A. N. A. Patented [1]
PMID27109571-Compound-27 DMXRTH4 N. A. N. A. Patented [1]
PMID27109571-Compound-28 DMTZVY3 N. A. N. A. Patented [1]
PMID27109571-Compound-29 DMDMEHQ N. A. N. A. Patented [1]
PMID27109571-Compound-30 DM24FSP N. A. N. A. Patented [1]
PMID27109571-Compound-31 DMU690T N. A. N. A. Patented [1]
PMID27109571-Compound-7 DM8GYCD N. A. N. A. Patented [1]
PMID27109571-Compound-8 DMTKFX7 N. A. N. A. Patented [1]
PMID27109571-Compound-9 DMWM03O N. A. N. A. Patented [1]
------------------------------------------------------------------------------------
⏷ Show the Full List of 25 Patented Agent(s)
15 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
1-benzyl-2,3-dimethyl-1H-indole-7-carboxylic acid DMQFS2D Discovery agent N.A. Investigative [2]
2-(2,3-bis(2-chlorobenzyloxy)phenyl)acetic acid DM1T8IP Discovery agent N.A. Investigative [3]
2-(3-Methyl-indole-1-sulfonyl)-benzoic acid DMFOA6R Discovery agent N.A. Investigative [4]
2-(4-Fluoro-indole-1-sulfonyl)-benzoic acid DMKFIEY Discovery agent N.A. Investigative [4]
2-(4-Methyl-indole-1-sulfonyl)-benzoic acid DM943YL Discovery agent N.A. Investigative [4]
2-(5-Bromo-indole-1-sulfonyl)-benzoic acid DMXRYDL Discovery agent N.A. Investigative [4]
2-(6-Methoxy-indole-1-sulfonyl)-benzoic acid DM41UYN Discovery agent N.A. Investigative [4]
2-(Carbazole-9-sulfonyl)-benzoic acid DMA6P4J Discovery agent N.A. Investigative [4]
3-Carbazol-9-yl-propionic acid DMHUBT5 Discovery agent N.A. Investigative [4]
4-Carbazol-9-yl-butyric acid DM74GWO Discovery agent N.A. Investigative [4]
5-Carbazol-9-yl-pentanoic acid DM04WVH Discovery agent N.A. Investigative [4]
BMS-480404 DMTPNI4 Discovery agent N.A. Investigative [3]
Hexadecanoic acid DMWUXDZ Discovery agent N.A. Investigative [4]
LINOLEIC ACID DMDGPY9 Discovery agent N.A. Investigative [5]
OLEIC ACID DM54O1Z Discovery agent N.A. Investigative [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 15 Investigative Drug(s)

References

1 Fatty acid binding protein (FABP) inhibitors: a patent review (2012-2015).Expert Opin Ther Pat. 2016 Jul;26(7):767-76.
2 N-Benzyl-indolo carboxylic acids: Design and synthesis of potent and selective adipocyte fatty-acid binding protein (A-FABP) inhibitors. Bioorg Med Chem Lett. 2009 Mar 15;19(6):1745-8.
3 NMR structure of a potent small molecule inhibitor bound to human keratinocyte fatty acid-binding protein. J Med Chem. 2006 Aug 10;49(16):5013-7.
4 Discovery of inhibitors of human adipocyte fatty acid-binding protein, a potential type 2 diabetes target. Bioorg Med Chem Lett. 2004 Sep 6;14(17):4445-8.
5 Discovery of highly selective inhibitors of human fatty acid binding protein 4 (FABP4) by virtual screening. Bioorg Med Chem Lett. 2010 Jun 15;20(12):3675-9.