Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTI6V2A)

• DTT Name: Heme oxygenase 1 (HMOX1)
• Synonyms: HO1; HO-1; HO
• Gene Name: HMOX1
• DTT Type: Clinical trial target; [1]
• Related Disease: Neonatal hyperbilirubinaemia [ICD-11: KA87]
• BioChemical Class: Paired donor oxygen oxidoreductase
• UniProt ID: HMOX1_HUMAN
• TTD ID: T25703
• EC Number: EC 1.14.14.18
• Sequence:
  MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVA
  LEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHE
  VGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ
  LYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRA
  SNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM
• Function: Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.
• KEGG Pathway:
  Porphyrin and chlorophyll metabolism (hsa00860)
  HIF-1 signaling pathway (hsa04066)
  Mineral absorption (hsa04978)
  MicroRNAs in cancer (hsa05206)
• Reactome Pathway: Iron uptake and transport (R-HSA-917937)
• BioCyc Pathway: MetaCyc:HS02027-MON

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Stannsoporfin	DMEG4TC	Neonatal hyperbilirubinemia	KA87	Phase 2	[1]

9 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
1-(adamantan-1-yl)-2-(1H-imidazol-1-yl)ethanone	DMOTJWZ	Discovery agent	N.A.	Investigative	[2]
12-Phenylheme	DMLR2FB	Discovery agent	N.A.	Investigative	[3]
2-Phenylheme	DMPIQTE	Discovery agent	N.A.	Investigative	[3]
2-Propanol, Isopropanol	DML5O0H	Discovery agent	N.A.	Investigative	[3]
Biliverdine Ix Alpha	DMCA0WJ	N. A.	N. A.	Investigative	[3]
Formic Acid	DMNFZC6	Discovery agent	N.A.	Investigative	[3]
Heme	DMGC287	Discovery agent	N.A.	Investigative	[2]
Tin protoporphyrin	DMTXJ5S	Discovery agent	N.A.	Investigative	[4]
Verdoheme	DM7NRK5	Discovery agent	N.A.	Investigative	[5]

References

• [1] Chemoprevention of severe neonatal hyperbilirubinemia. Semin Perinatol. 2004 Oct;28(5):365-8.
• [2] The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
• [3] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [4] Adenovirus-mediated heme oxygenase-1 gene delivery inhibits injury-induced vascular neointima formation. Circulation. 2001 Nov 27;104(22):2710-5.
• [5] DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.