Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTIV96N)

• DTT Name: Fatty acid-binding protein 1 (FABP1)
• Synonyms: L-FABP; FABP1; 14-kDa fatty-acid binding protein; 14 kDa selenium-binding protein
• Gene Name: FABP1
• DTT Type: Successful target; [1]
• UniProt ID: FABPL_HUMAN
• TTD ID: T73712
• Sequence:
  MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQ
  NEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVF
  KRISKRI
• Function: Binds free fatty acids andtheir coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport.
• KEGG Pathway:
  PPAR signaling pathway (hsa03320)
  Fat digestion and absorption (hsa04975)
• Reactome Pathway:
  PPARA activates gene expression (R-HSA-1989781)
  Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) (R-HSA-400206)
  Hormone-sensitive lipase (HSL)-mediated triacylglycerol hydrolysis (R-HSA-163560)

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
FENOFIBRIC ACID	DMGO2MC	Cardiovascular disease	BA00-BE2Z	Approved	[1]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
INDOPROFEN	DM5QSKN	Gout	FA25	Withdrawn from market	[1]

2 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
1-anilinonaphthalene-8-sulfonic acid	DMNGY0E	N. A.	N. A.	Investigative	[1]
OLEIC ACID	DM54O1Z	Discovery agent	N.A.	Investigative	[1]

References

• [1] Characterization of the drug binding specificity of rat liver fatty acid binding protein. J Med Chem. 2008 Jul 10;51(13):3755-64.