Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTJCPUT)

• DTT Name: Coagulation factor XI (F11)
• Synonyms: Plasma thromboplastin antecedent; PTA; FXI
• Gene Name: F11
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Peptidase
• UniProt ID: FA11_HUMAN
• TTD ID: T46040
• EC Number: EC 3.4.21.27
• Sequence:
  MIFLYQVVHFILFTSVSGECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFT
  FTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDM
  KGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITK
  LDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFT
  FFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTD
  FLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKIL
  HGRGGISGYTLRLCKMDNECTTKIKPRIVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSI
  IGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYD
  IALLKLETTVNYTDSQRPICLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLV
  TNEECQKRYRGHKITHKMICAGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCA
  QRERPGVYTNVVEYVDWILEKTQAV
• Function: Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX.
• KEGG Pathway: Complement and coagulation cascades (hsa04610)
• Reactome Pathway:
  Defective F9 activation (R-HSA-9673221)
  Intrinsic Pathway of Fibrin Clot Formation (R-HSA-140837)

Molecular Interaction Atlas (MIA) of This DTT

7 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
A186	DMHJ0EB	Clotting disorder	3B4Z	IND submitted	[2]
Asundexian	DMLZMU2	Ischemic stroke	8B11.5Z	Phase 3	[3]
Abelacimab	DM09YTN	Atrial fibrillation	BC81.3	Phase 2	[4]
MK-2060	DM79A32	Thrombosis	DB61-GB90	Phase 2	[5]
A336	DMVQG8G	Clotting disorder	3B4Z	Phase 1	[2]
AB023	DMBG9HI	End-stage renal disease	GB61.5	Phase 1	[6]
EP-7041	DMV0MHI	Thrombosis	DB61-GB90	Phase 1	[1]

References

• [1] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [2] Clinical pipeline report, company report or official report of Klus Pharma
• [3] Pharmacological profile of asundexian, a novel, orally bioavailable inhibitor of factor XIa. J Thromb Haemost. 2022 Jun;20(6):1400-1411.
• [4] Pharmacokinetics and pharmacodynamics of Abelacimab (MAA868), a novel dual inhibitor of Factor XI and Factor XIa. J Thromb Haemost. 2022 Feb;20(2):307-315.
• [5] Clinical pipeline report, company report or official report of MSD
• [6] Contact Activation Inhibitor and Factor XI Antibody, AB023, Produces Safe, Dose-Dependent Anticoagulation in a Phase 1 First-In-Human Trial. Arterioscler Thromb Vasc Biol. 2019 Apr;39(4):799-809.