| DTT Name |
HUMAN interleukin 6 (IL6)
|
| Synonyms |
Interferon beta-2; IL-6; IFNB2; IFN-beta-2; Hybridoma growth factor; CTL differentiation factor; CDF; BSF-2; B-cell stimulatory factor 2 |
| Gene Name |
IL6
|
| BioChemical Class |
Cytokine: interleukin
|
| UniProt ID |
|
| TTD ID |
|
| 3D Structure |
|
| Sequence |
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
|
| Function |
It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation. Cytokine with a wide variety of biological functions.
|
| KEGG Pathway |
- EGFR tyrosine kinase inhibitor resistance (hsa01521 )
- Antifolate resistance (hsa01523 )
- Cytokine-cytokine receptor interaction (hsa04060 )
- Viral protein interaction with cytokine and cytokine receptor (hsa04061 )
- HIF-1 signaling pathway (hsa04066 )
- FoxO signaling pathway (hsa04068 )
- PI3K-Akt signaling pathway (hsa04151 )
- Cellular senescence (hsa04218 )
- Toll-like receptor signaling pathway (hsa04620 )
- NOD-like receptor signaling pathway (hsa04621 )
- Cytosolic DNA-sensing pathway (hsa04623 )
- C-type lectin receptor signaling pathway (hsa04625 )
- JAK-STAT signaling pathway (hsa04630 )
- Hematopoietic cell lineage (hsa04640 )
- IL-17 signaling pathway (hsa04657 )
- Th17 cell differentiation (hsa04659 )
- TNF signaling pathway (hsa04668 )
- Intestinal immune network for IgA production (hsa04672 )
- Insulin resistance (hsa04931 )
- Non-alcoholic fatty liver disease (hsa04932 )
- AGE-RAGE signaling pathway in diabetic complications (hsa04933 )
- Alcoholic liver disease (hsa04936 )
- Alzheimer disease (hsa05010 )
- Prion disease (hsa05020 )
- Pathways of neurodegeneration - multiple diseases (hsa05022 )
- Pathogenic Escherichia coli infection (hsa05130 )
- Salmonella infection (hsa05132 )
- Pertussis (hsa05133 )
- Legionellosis (hsa05134 )
- Yersinia infection (hsa05135 )
- Chagas disease (hsa05142 )
- African trypanosomiasis (hsa05143 )
- Malaria (hsa05144 )
- Amoebiasis (hsa05146 )
- Tuberculosis (hsa05152 )
- Hepatitis B (hsa05161 )
- Measles (hsa05162 )
- Human cytomegalovirus infection (hsa05163 )
- Influenza A (hsa05164 )
- Human T-cell leukemia virus 1 infection (hsa05166 )
- Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
- Herpes simplex virus 1 infection (hsa05168 )
- Epstein-Barr virus infection (hsa05169 )
- Coronavirus disease - COVID-19 (hsa05171 )
- Pathways in cancer (hsa05200 )
- Transcriptional misregulation in cancer (hsa05202 )
- Inflammatory bowel disease (hsa05321 )
- Rheumatoid arthritis (hsa05323 )
- Graft-versus-host disease (hsa05332 )
- Hypertrophic cardiomyopathy (hsa05410 )
- Lipid and atherosclerosis (hsa05417 )
|
| Reactome Pathway |
- MAPK3 (ERK1) activation (R-HSA-110056 )
- MAPK1 (ERK2) activation (R-HSA-112411 )
- Senescence-Associated Secretory Phenotype (SASP) (R-HSA-2559582 )
- Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426 )
- Interleukin-10 signaling (R-HSA-6783783 )
- Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 )
- Transcriptional Regulation by VENTX (R-HSA-8853884 )
- Post-translational protein phosphorylation (R-HSA-8957275 )
- ADORA2B mediated anti-inflammatory cytokines production (R-HSA-9660821 )
- CD163 mediating an anti-inflammatory response (R-HSA-9662834 )
- Interleukin-6 signaling (R-HSA-1059683 )
|
|
|
|
|
|
|
