Details of the Drug

General Information of Drug (ID: DMGEATB)

Drug Name

Siltuximab

Indication

Disease Entry	ICD 11	Status	REF
Anemia	3A00-3A9Z	Approved	[1], [2], [3]
Multiple myeloma	2A83	Phase 2	[4]

Drug Type

Antibody

Sequence

>heavy chain
EVQLVESGGKLLKPGGSLKLSCAASGFTFSSFAMSWFRQSPEKRLEWVAEISSGGSYTYY
PDTVTGRFTISRDNAKNTLYLEMSSLRSEDTAMYYCARGLWGYYALDYWGQGTSVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
>light chain
QIVLIQSPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDTSNLASGVPVR
FSGSGSGTSYSLTISRMEAEDAATYYCQQWSGYPYTFGGGTKLEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

ADMET Property

Half-life: The concentration or amount of drug in body reduced by one-half in 20.6 days [5]
Vd: The volume of distribution (Vd) of drug is 4.5 L [6]

Cross-matching ID

DrugBank ID: DB09036
TTD ID: D07NJN

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Interleukin-6 (IL6)	TTT1V78	IL6_HUMAN	Not Available	[2], [3]

------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease

Anemia

ICD Disease Classification

3A00-3A9Z

Molecule Name	Molecule Type	Gene Name	p-value	Fold-Change	Z-score
Interleukin-6 (IL6)	DTT	IL6	8.08E-01	-0.77	-1.15

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Siltuximab (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Oliceridine	DM6MDCF	Moderate	Altered metabolism of Siltuximab due to Oliceridine alters the formation of CYP450 enzymes.	Acute pain [MG31]	[13]
Levonorgestrel	DM1DP7T	Moderate	Altered metabolism of Siltuximab due to Levonorgestrel alters the formation of CYP450 enzymes.	Contraceptive management [QA21]	[13]
Oestradiol valerate and dienogest	DMZK0FQ	Moderate	Altered metabolism of Siltuximab due to Oestradiol valerate and dienogest alters the formation of CYP450 enzymes.	Endometriosis [GA10]	[13]
Levamlodipine	DM92S6N	Moderate	Altered metabolism of Siltuximab due to Levamlodipine alters the formation of CYP450 enzymes.	Hypertension [BA00-BA04]	[14]
Lurbinectedin	DMEFRTZ	Moderate	Additive immunosuppressive effects by the combination of Siltuximab and Lurbinectedin.	Lung cancer [2C25]	[14]
GDC-0199	DMH0QKA	Moderate	Altered metabolism of Siltuximab due to GDC-0199 alters the formation of CYP450 enzymes.	Mature B-cell leukaemia [2A82]	[14]
Siponimod	DM2R86O	Major	Additive immunosuppressive effects by the combination of Siltuximab and Siponimod.	Multiple sclerosis [8A40]	[15]
Ocrelizumab	DMEZ2KH	Moderate	Additive immunosuppressive effects by the combination of Siltuximab and Ocrelizumab.	Multiple sclerosis [8A40]	[16]
Ozanimod	DMT6AM2	Major	Additive immunosuppressive effects by the combination of Siltuximab and Ozanimod.	Multiple sclerosis [8A40]	[14]
Anthrax vaccine	DM9GSWY	Moderate	Antagonize the effect of Siltuximab when combined with Anthrax vaccine.	Sepsis [1G40-1G41]	[17]
-----------


⏷ Show the Full List of 10 DDI Information of This Drug

References

1	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7396).
2	2014 FDA drug approvals. Nat Rev Drug Discov. 2015 Feb;14(2):77-81.
3	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
4	Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
5	Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
6	An FDA phase I clinical trial of quinacrine sterilization (QS). Int J Gynaecol Obstet. 2003 Oct;83 Suppl 2:S45-9.
7	Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
8	Efficacy and safety of olokizumab in patients with rheumatoid arthritis with an inadequate response to TNF inhibitor therapy: outcomes of a randomised Phase IIb study. Ann Rheum Dis. 2014 September; 73(9): 1607-1615.
9	Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
10	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020380)
11	Whole-molecule antibody engineering: generation of a high-affinity anti-IL-6 antibody with extended pharmacokinetics. J Mol Biol. 2011 Aug 26;411(4):791-807.
12	The molecular basis of hepcidin-resistant hereditary hemochromatosis. Blood. 2009 Jul 9;114(2):437-43.
13	Product Information. Cosentyx (secukinumab). Novartis Pharmaceuticals, East Hanover, NJ.
14	Cerner Multum, Inc. "UK Summary of Product Characteristics.".
15	Cerner Multum, Inc. "Australian Product Information.".
16	Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
17	CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]