Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTL31H0)

• DTT Name: OX40L receptor (CD134)
• Synonyms: Tumor necrosis factor receptor superfamily member 4; TXGP1L; TAX transcriptionally-activated glycoprotein 1 receptor; CD134; ACT35 antigen
• Gene Name: TNFRSF4
• DTT Type: Clinical trial target; [1]
• UniProt ID: TNR4_HUMAN
• TTD ID: T92124
• Sequence:
  MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQ
  NTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYK
  PGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQ
  GPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILLALYLL
  RRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI
• Function: Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity.
• KEGG Pathway: Cytokine-cytokine receptor interaction (hsa04060)
• Reactome Pathway: TNFs bind their physiological receptors (R-HSA-5669034)

Molecular Interaction Atlas (MIA) of This DTT

10 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Rocatinlimab	DMG1U5K	Atopic dermatitis	EA80	Phase 3	[2]
GBR 830	DM2VO9T	Atopic dermatitis	EA80	Phase 2	[1]
INCAGN01949	DMK7OHI	Advanced malignancy	2A00-2F9Z	Phase 2	[3]
PF-04518600	DMZMUIL	Solid tumour/cancer	2A00-2F9Z	Phase 2	[4]
INCAGN1949	DM7OE3X	Solid tumour/cancer	2A00-2F9Z	Phase 1/2	[5]
Anti-OX40 mab	DMFZ52G	Prostate cancer	2C82.0	Phase 1	[6]
BGB-A445	DMQMEDH	Solid tumour/cancer	2A00-2F9Z	Phase 1	[7]
MEDI0562	DMYVBU6	Solid tumour/cancer	2A00-2F9Z	Phase 1	[4]
TAK-252	DM1AKNI	Solid tumour/cancer	2A00-2F9Z	Phase 1	[8]
YH002	DMWVRHD	Aggressive cancer	2A00-2F9Z	Phase 1	[9]

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
YH006	DMRECC2	Aggressive cancer	2A00-2F9Z	Investigative	[10]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Prostate cancer	2C82	Prostate	2.17E-06	1.01	1.66
Asthma	CA23	Nasal and bronchial airway	1.87E-01	-0.08	-0.1

References

• [1] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [2] An anti-OX40 antibody to treat moderate-to-severe atopic dermatitis: a multicentre, double-blind, placebo-controlled phase 2b study. Lancet. 2023 Jan 21;401(10372):204-214.
• [3] Sequential therapy with INCAGN01949 followed by ipilimumab and nivolumab in two patients with advanced ovarian carcinoma. Gynecol Oncol Rep. 2020 Oct 1;34:100655.
• [4] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [5] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [6] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1873).
• [7] Clinical pipeline report, company report or official report of BeiGene.
• [8] Clinical pipeline report, company report or official report of Shattuck Labs.
• [9] Clinical pipeline report, company report or official report of Biocytogen
• [10] Clinical pipeline report, company report or official report of Biocytogen