Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTL9OD4)

• DTT Name: Transmembrane activator and CAML interactor (TNFRSF13B)
• Synonyms: Tumor necrosis factor receptor superfamily member 13B; TACI; CD267
• Gene Name: TNFRSF13B
• DTT Type: Clinical trial target; [1]
• UniProt ID: TR13B_HUMAN
• TTD ID: T99394
• Sequence:
  MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQR
  TCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRR
  QRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYSTLGLCLCAVLCCFLV
  AVACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAP
  TQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA
• Function: Mediates calcineurin-dependent activation of NF-AT, as well as activation of NF-kappa-B and AP-1. Involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. Receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS that binds both ligands with similar high affinity.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Intestinal immune network for IgA production (hsa04672)
  Primary immunodeficiency (hsa05340)
• Reactome Pathway: TNFs bind their physiological receptors (R-HSA-5669034)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AUTO2	DM0PWX2	Multiple myeloma	2A83	Phase 1/2	[1]

References

• [1] ClinicalTrials.gov (NCT03287804) APRIL CAR T Cells (AUTO2) Targeting BCMA and TACI for the Treatment of Multiple Myeloma