Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTLCKI8)
DTT Name | Blood group Rh(D) polypeptide (RHD) | ||||
---|---|---|---|---|---|
Synonyms | Rhesus D antigen; RhPII; Rh polypeptide 2; RHXIII; RHD; CD240D | ||||
Gene Name | RHD | ||||
DTT Type |
Clinical trial target
|
[1] | |||
BioChemical Class |
Ammonia transporter channel
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MSSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAI
GLGFLTSSFRRHSWSSVAFNLFMLALGVQWAILLDGFLSQFPSGKVVITLFSIRLATMSA LSVLISVDAVLGKVNLAQLVVMVLVEVTALGNLRMVISNIFNTDYHMNMMHIYVFAAYFG LSVAWCLPKPLPEGTEDKDQTATIPSLSAMLGALFLWMFWPSFNSALLRSPIERKNAVFN TYYAVAVSVVTAISGSSLAHPQGKISKTYVHSAVLAGGVAVGTSCHLIPSPWLAMVLGLV AGLISVGGAKYLPGCCNRVLGIPHSSIMGYNFSLLGLLGEIIYIVLLVLDTVGAGNGMIG FQVLLSIGELSLAIVIALMSGLLTGLLLNLKIWKAPHEAKYFDDQVFWKFPHLAVGF |
||||
Function | May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane. | ||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
1 Discontinued Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
Molecular Expression Atlas (MEA) of This DTT
References
1 | Pharmacokinetics and safety of roledumab, a novel human recombinant monoclonal anti-RhD antibody with an optimized Fc for improved engagement of FCgammaRIII, in healthy volunteers. Vox Sang. 2012 Oct;103(3):213-22. | ||||
---|---|---|---|---|---|
2 | Rozrolimupab, symphobodies against rhesus D, for the potential prevention of hemolytic disease of the newborn and the treatment of idiopathic thrombocytopenic purpura. Curr Opin Mol Ther. 2010 Dec;12(6):734-40. | ||||