Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTLK9NJ)

• DTT Name: Pseudomonas PcrV protein type III (Pseudo pcrV)
• Synonyms: Type III secretion protein PcrV; Pseudo Virulence-associated V antigen; Pseudo Low calcium response locus protein V; PcrV
• Gene Name: Pseudo pcrV
• DTT Type: Clinical trial target; [1]
• UniProt ID: O30527_PSEAI
• TTD ID: T22415
• Sequence:
  MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALA
  WLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDV
  LQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYA
  VGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNF
  ATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
• Function: Essential for cytotoxicity. Found both within the bacterial cytoplasm and localized extracellularly.

Molecular Interaction Atlas (MIA) of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
KB001A	DMTMCPZ	Cystic fibrosis	CA25	Phase 2	[2]
MEDI3902	DMOXKIC	Ventilator-associated pneumonia	PK81.0	Phase 2	[3]

References

• [1] Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
• [2] KB001-A, a novel anti-inflammatory, found to be safe and well-tolerated in cystic fibrosis patients infected with Pseudomonas aeruginosa. J Cyst Fibros. 2018 Jul;17(4):484-491.
• [3] A multifunctional bispecific antibody protects against Pseudomonas aeruginosa. Sci Transl Med. 2014 Nov 12;6(262):262ra155.