Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTMPHAE)

• DTT Name: C-C motif chemokine 17 (CCL17)
• Synonyms: CC chemokine TARC; Small-inducible cytokine A17; Thymus and activation-regulated chemokine
• Gene Name: CCL17
• DTT Type: Clinical trial target; [1]
• UniProt ID: CCL17_HUMAN
• TTD ID: T63236
• Sequence:
  MAPLKMLALVTLLLGASLQHIHAARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRD
  AIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
• Function: Chemokine, which displays chemotactic activity for T lymphocytes, preferentially Th2 cells, but not monocytes or granulocytes. Therefore plays an important role in a wide range of inflammatory and immunological processes (PubMed:8702936, PubMed:9169480). Acts by binding to CCR4 at T-cell surface (PubMed:9169480, PubMed:10540332). Mediates GM-CSF/CSF2-driven pain and inflammation (PubMed:27525438). In the brain, required to maintain the typical, highly branched morphology of hippocampal microglia under homeostatic conditions. May be important for the appropriate adaptation of microglial morphology and synaptic plasticity to acute lipopolysaccharide (LPS)-induced neuroinflammation (By similarity). Plays a role in wound healing, mainly by inducing fibroblast migration into the wound (By similarity). {ECO:0000250|UniProtKB:Q9WUZ6, ECO:0000269|PubMed:10540332, ECO:0000269|PubMed:27525438, ECO:0000269|PubMed:8702936, ECO:0000269|PubMed:9169480}.
• KEGG Pathway: 6361 (hsa)
• Reactome Pathway: (R-HSA-380108)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
GSK3858279	DME4US7	Osteoarthritis pain	MG30.31	Phase 2	[1]

References

• [1] Therapeutic options for targeting inflammatory osteoarthritis pain. Nat Rev Rheumatol. 2019 Jun;15(6):355-363.