Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTOISYB)
DTT Name | Proto-oncogene Mas (MAS) | ||||
---|---|---|---|---|---|
Synonyms | MGRA; MAS1 proto-oncogene, G protein-coupled receptor | ||||
Gene Name | MAS1 | ||||
DTT Type |
Clinical trial target
|
[1] | |||
BioChemical Class |
GPCR rhodopsin
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MDGSNVTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLWFLCFR
MRRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHYYTIVTLSVTFLFGYNTGL YLLTAISVERCLSVLYPIWYRCHRPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHS RNDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIFLIF AMPMRLLYLLYYEYWSTFGNLHHISLLFSTINSSANPFIYFFVGSSKKKRFKESLKVVLT RAFKDEMQPRRQKDNCNTVTVETVV |
||||
Function |
Acts specifically as a functional antagonist of AGTR1 (angiotensin-2 type 1 receptor), although it up-regulates AGTR1 receptor levels. Positive regulation of AGTR1 levels occurs through activation of the G-proteins GNA11 and GNAQ, and stimulation of the protein kinase C signaling cascade. The antagonist effect on AGTR1 function is probably due to AGTR1 being physically altered by MAS1. Receptor for angiotensin 1-7.
|
||||
KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
2 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||||||||
3 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||||||||
Molecular Expression Atlas (MEA) of This DTT
References
1 | New therapeutic pathways in the RAS. J Renin Angiotensin Aldosterone Syst. 2012 Dec;13(4):505-8. | ||||
---|---|---|---|---|---|
2 | Inhibition of Mas G-protein signaling improves coronary blood flow, reduces myocardial infarct size, and provides long-term cardioprotection. Am J Physiol Heart Circ Physiol. 2012 Jan 1;302(1):H299-311. | ||||
3 | Nonpeptide AVE 0991 is an angiotensin-(1-7) receptor Mas agonist in the mouse kidney. Hypertension. 2004 Oct;44(4):490-6. | ||||