Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTPO9ZI)

DTT Name SNCA messenger RNA (SNCA mRNA)
Synonyms
PARK1 (mRNA); NonA4 component of amyloid precursor (mRNA); NonA beta component of AD amyloid (mRNA); Non-A4 component of amyloid precursor (mRNA); Non-A beta component of AD amyloid (mRNA); NACP (mRNA)
Gene Name SNCA
DTT Type
Literature-reported target
 [1]
BioChemical Class
mRNA target
UniProt ID
SYUA_HUMAN
TTD ID
T27816
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA
Function
Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores. Mechanistically, acts by increasing local Ca(2+) release from microdomains which is essential for the enhancement of ATP-induced exocytosis. Acts also as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs (Soluble NSF Attachment Protein REceptors) at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5. This chaperone activity is important to sustain normal SNARE-complex assembly during aging. Plays also a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter (DAT1) and thereby modulating its activity. Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release.
KEGG Pathway
Alzheimer disease (hsa05010 )
Parkinson disease (hsa05012 )
Pathways of neurodegeneration - multiple diseases (hsa05022 )
Reactome Pathway
Amyloid fiber formation (R-HSA-977225 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
1 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
ION464 DMZAQS8 Multiple system atrophy 8D87.0 Phase 1 [2]
------------------------------------------------------------------------------------

References

1 Elevated mRNA Expression and Low Methylation of SNCA in Japanese Alzheimer's Disease Subjects. J Alzheimers Dis. 2016 Oct 18;54(4):1349-1357.
2 Clinical pipeline report, company report or official report of Ionis