Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTQOVYA)

• DTT Name: C-X-C motif chemokine 10 (CXCL10)
• Synonyms: Small-inducible cytokine B10; SCYB10; IP-10; INP10; Gamma-IP10; 10 kDa interferon gamma-induced protein
• Gene Name: CXCL10
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Cytokine: CXC chemokine
• UniProt ID: CXL10_HUMAN
• TTD ID: T30635
• Sequence:
  MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRV
  EIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
• Function: Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects. Plays thereby an important role during viral infections by stimulating the activation and migration of immune cells to the infected sites (By similarity). Mechanistically, binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling and results in downstream activation of phospholipase C-dependent pathway, an increase in intracellular calcium production and actin reorganization. In turn, recruitment of activated Th1 lymphocytes occurs at sites of inflammation. Activation of the CXCL10/CXCR3 axis plays also an important role in neurons in response to brain injury for activating microglia, the resident macrophage population of the central nervous system, and directing them to the lesion site. This recruitment is an essential element for neuronal reorganization (By similarity).
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Chemokine signaling pathway (hsa04062)
  Toll-like receptor signaling pathway (hsa04620)
  RIG-I-like receptor signaling pathway (hsa04622)
  Cytosolic DNA-sensing pathway (hsa04623)
  TNF signaling pathway (hsa04668)
  Influenza A (hsa05164)
• Reactome Pathway:
  G alpha (i) signalling events (R-HSA-418594)
  Chemokine receptors bind chemokines (R-HSA-380108)

Molecular Interaction Atlas (MIA) of This DTT

6 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Anti-IP10	DMVRNAO	Crohn disease	DD70	Phase 2	[1]
BMS-936557	DMUTS1W	Immune System disease	4A01-4B41	Phase 2	[1]
JT02	DMXTKCR	Inflammatory bowel disease	DD72	Phase 2	[2]
MDX-1100	DM0EZWI	Crohn disease	DD70	Phase 2	[3]
NI-0801	DMRQUH4	Autoimmune diabetes	5A10	Phase 2	[4]
NG-641	DMITVHM	Solid tumour/cancer	2A00-2F9Z	Phase 1	[5]

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
N-Methylleucine	DM9AGCV	Discovery agent	N.A.	Investigative	[6]

References

• [1] Anti-IP-10 antibody (BMS-936557) for ulcerative colitis: a phase II randomised study. Gut. 2014 Mar;63(3):442-50.
• [2] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [3] A phase II, randomized, double-blind, placebo-controlled study evaluating the efficacy and safety of MDX-1100, a fully human anti-CXCL10 monoclonal antibody, in combination with methotrexate in patients with rheumatoid arthritis. Arthritis Rheum. 2012 Jun;64(6):1730-9.
• [4] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029267)
• [5] Clinical pipeline report, company report or official report of PsiOxus Therapeutics.
• [6] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.