Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTQT5S9)

DTT Name	Cambridge pathology 1 antigen (CD52)
Synonyms	Epididymal secretory protein E5; CDW52; CD52 antigen; CD52
Gene Name	CD52
DTT Type	Successful target	[1]
UniProt ID	CD52_HUMAN
TTD ID	T76630
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCF S
Function	May play a role in carrying and orienting carbohydrate, as well as having a more specific role.
Reactome Pathway	Post-translational modification (R-HSA-163125 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Alemtuzumab	DMZL3IV	Acute myelogenous leukaemia	2A41	Approved	[1]
------------------------------------------------------------------------------------

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
GZ402668	DME6VX4	Multiple sclerosis	8A40	Phase 1	[2]
------------------------------------------------------------------------------------

References

1	Identifying alemtuzumab as an anti-myeloid cell antiangiogenic therapy for the treatment of ovarian cancer. J Transl Med. 2009 Jun 19;7:49.
2	Characterization of a Next Generation Anti-CD52 Antibody. Neurology. April 6, 2015 vol. 84 no. 14.