Details of the Drug

General Information of Drug (ID: DMZL3IV)

Drug Name
Alemtuzumab
Synonyms Campath (TN); MabCampath (TN); Campath-1H (TN)
Indication
Disease Entry ICD 11 Status REF
Acute myelogenous leukaemia 2A41 Approved [1]
Chronic lymphocytic leukaemia 2A82.0 Approved [2]
Immunodeficiency 4A00-4A85 Approved [3]
Leukemia N.A. Approved [4]
Multiple sclerosis 8A40 Approved [2]
Myeloproliferative neoplasm 2A20 Approved [5]
Systemic lupus erythematosus 4A40.0 Approved [6]
Systemic sclerosis 4A42 Approved [7]
Neuroblastoma 2D11.2 Investigative [8]
⏷ Show the Full List of Indication(s)
Therapeutic Class
Anticancer Agents
Drug Type
Antibody
Sequence
>heavy chain 1
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT
EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>light chain 1
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR
>heavy chain 2
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT
EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>light chain 2
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR
ADMET Property
Half-life
The concentration or amount of drug in body reduced by one-half in 288 hours [9]
Metabolism
The drug is metabolized via opsonization via the reticuloendothelial system []
Vd
The volume of distribution (Vd) of drug is 0.18 L/kg []
Cross-matching ID
DrugBank ID
DB00087
TTD ID
D01ZYG
Repurposed Drugs (RPD) Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Cambridge pathology 1 antigen (CD52) TTQT5S9 CD52_HUMAN Not Available [10]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Alemtuzumab
DDI Drug Name DDI Drug ID Severity Mechanism Disease REF
Pentostatin DM0HXDS Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Pentostatin. Mature B-cell leukaemia [2A82] [11]
Ofatumumab DM295PR Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Ofatumumab. Mature B-cell leukaemia [2A82] [11]
Obinutuzumab DM3BVAE Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Obinutuzumab. Mature B-cell leukaemia [2A82] [11]
Cladribine DM3JDRP Major Additive immunosuppressive effects by the combination of Alemtuzumab and Cladribine. Mature B-cell leukaemia [2A82] [12]
Idelalisib DM602WT Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Idelalisib. Mature B-cell leukaemia [2A82] [11]
GDC-0199 DMH0QKA Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and GDC-0199. Mature B-cell leukaemia [2A82] [11]
Chlorambucil DMRKE63 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Chlorambucil. Mature B-cell leukaemia [2A82] [11]
IPI-145 DMWA24P Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and IPI-145. Mature B-cell leukaemia [2A82] [11]
⏷ Show the Full List of 8 DDI Information of This Drug
Coadministration of a Drug Treating the Disease Different from Alemtuzumab (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Thioguanine DM7NKEV Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Thioguanine. Acute myeloid leukaemia [2A60] [11]
Uracil mustard DMHL7OB Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Uracil mustard. Acute myeloid leukaemia [2A60] [11]
Midostaurin DMI6E0R Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Midostaurin. Acute myeloid leukaemia [2A60] [11]
Idarubicin DMM0XGL Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Idarubicin. Acute myeloid leukaemia [2A60] [11]
Daunorubicin DMQUSBT Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Daunorubicin. Acute myeloid leukaemia [2A60] [11]
Siltuximab DMGEATB Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Siltuximab. Anemia [3A00-3A9Z] [11]
Budesonide DMJIBAW Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Budesonide. Asthma [CA23] [11]
Roflumilast DMPGHY8 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Roflumilast. Asthma [CA23] [12]
Dupilumab DMOAD2Y Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Dupilumab. Atopic eczema [EA80] [11]
Chloramphenicol DMFXEWT Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Chloramphenicol. Bacterial infection [1A00-1C4Z] [11]
Linezolid DMGFPU2 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Linezolid. Bacterial infection [1A00-1C4Z] [11]
Temozolomide DMKECZD Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Temozolomide. Brain cancer [2A00] [11]
Lomustine DMMWSUL Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Lomustine. Brain cancer [2A00] [11]
Eribulin DM1DX4Q Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Eribulin. Breast cancer [2C60-2C6Y] [11]
Talazoparib DM1KS78 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Talazoparib. Breast cancer [2C60-2C6Y] [11]
Ixabepilone DM2OZ3G Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Ixabepilone. Breast cancer [2C60-2C6Y] [11]
LY2835219 DM93VBZ Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and LY2835219. Breast cancer [2C60-2C6Y] [11]
Pralatrexate DMAO80I Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Pralatrexate. Breast cancer [2C60-2C6Y] [11]
Palbociclib DMD7L94 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Palbociclib. Breast cancer [2C60-2C6Y] [11]
Thiotepa DMIZKOP Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Thiotepa. Breast cancer [2C60-2C6Y] [11]
Cabazitaxel DMPAZHC Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Cabazitaxel. Breast cancer [2C60-2C6Y] [11]
Bosutinib DMTI8YE Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Bosutinib. Breast cancer [2C60-2C6Y] [11]
Corticotropin DMP9TWZ Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Corticotropin. Chronic kidney disease [GB61] [11]
Phenylbutazone DMAYL0T Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Phenylbutazone. Chronic pain [MG30] [11]
Irinotecan DMP6SC2 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Irinotecan. Colorectal cancer [2B91] [11]
Oxaliplatin DMQNWRD Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Oxaliplatin. Colorectal cancer [2B91] [11]
Aflibercept DMT3D5I Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Aflibercept. Colorectal cancer [2B91] [11]
Capecitabine DMTS85L Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Capecitabine. Colorectal cancer [2B91] [11]
Ardeparin DMYRX8B Moderate Increased risk of bleeding by the combination of Alemtuzumab and Ardeparin. Coronary thrombosis [BA43] [13]
Mycophenolic acid DMRBMAU Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Mycophenolic acid. Crohn disease [DD70] [11]
Polatuzumab vedotin DMF6Y0L Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Polatuzumab vedotin. Diffuse large B-cell lymphoma [2A81] [11]
Axicabtagene ciloleucel DMYHN59 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Axicabtagene ciloleucel. Diffuse large B-cell lymphoma [2A81] [11]
Flucytosine DM13VTW Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Flucytosine. Endocarditis [BB40-BA42] [11]
Felbamate DM1V5ZS Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Felbamate. Epilepsy/seizure [8A61-8A6Z] [11]
Mephenytoin DM5UGDK Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Mephenytoin. Epilepsy/seizure [8A61-8A6Z] [11]
Paramethadione DMR5ZUP Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Paramethadione. Epilepsy/seizure [8A61-8A6Z] [11]
Ethotoin DMXWOCP Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Ethotoin. Epilepsy/seizure [8A61-8A6Z] [11]
Carbamazepine DMZOLBI Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Carbamazepine. Epilepsy/seizure [8A61-8A6Z] [11]
Bay 80-6946 DMLOS5R Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Bay 80-6946. Follicular lymphoma [2A80] [11]
Pentamidine DMHZJCG Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Pentamidine. Fungal infection [1F29-1F2F] [11]
Avapritinib DMK2GZX Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Avapritinib. Gastrointestinal stromal tumour [2B5B] [11]
Colchicine DM2POTE Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Colchicine. Gout [FA25] [11]
177Lu-DOTATATE DMT8GVU Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and 177Lu-DOTATATE. Hepatitis virus infection [1E50-1E51] [11]
Bleomycin DMNER5S Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Bleomycin. Hodgkin lymphoma [2B30] [11]
Brentuximab vedotin DMWLC57 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Brentuximab vedotin. Hodgkin lymphoma [2B30] [11]
Zidovudine DM4KI7O Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Zidovudine. Human immunodeficiency virus disease [1C60-1C62] [11]
Teriflunomide DMQ2FKJ Major Additive immunosuppressive effects by the combination of Alemtuzumab and Teriflunomide. Hyper-lipoproteinaemia [5C80] [14]
Fludrocortisone DMUDIR8 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Fludrocortisone. Hypo-osmolality/hyponatraemia [5C72] [11]
Auranofin DMWE2N4 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Auranofin. Inflammatory arthropathy [FA2Z] [11]
Meclofenamic acid DM05FXR Moderate Increased risk of bleeding by the combination of Alemtuzumab and Meclofenamic acid. Inflammatory spondyloarthritis [FA92] [13]
Olaratumab DMNYOIX Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Olaratumab. Kaposi sarcoma [2B57] [11]
Methotrexate DM2TEOL Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Methotrexate. Leukaemia [2A60-2B33] [11]
Nelarabine DMB6VEG Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Nelarabine. Leukaemia [2A60-2B33] [11]
DTI-015 DMXZRW0 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and DTI-015. Liver cancer [2C12] [11]
Denosumab DMNI0KO Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Denosumab. Low bone mass disorder [FB83] [15]
Brigatinib DM7W94S Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Brigatinib. Lung cancer [2C25] [11]
Osimertinib DMRJLAT Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Osimertinib. Lung cancer [2C25] [11]
Belimumab DM3OBQF Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Belimumab. Lupus erythematosus [4A40] [11]
Primaquine DMWQ16I Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Primaquine. Malaria [1F40-1F45] [11]
Inotuzumab ozogamicin DMAC130 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Inotuzumab ozogamicin. Malignant haematopoietic neoplasm [2B33] [11]
Fludarabine DMVRLT7 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Fludarabine. Malignant haematopoietic neoplasm [2B33] [11]
Acalabrutinib DM7GCVW Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Acalabrutinib. Mature B-cell lymphoma [2A85] [11]
Clofarabine DMCVJ86 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Clofarabine. Mature B-cell lymphoma [2A85] [11]
Blinatumomab DMGECIJ Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Blinatumomab. Mature B-cell lymphoma [2A85] [11]
Ibrutinib DMHZCPO Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Ibrutinib. Mature B-cell lymphoma [2A85] [11]
Vincristine DMINOX3 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Vincristine. Mature B-cell lymphoma [2A85] [11]
Teniposide DMLW57T Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Teniposide. Mature B-cell lymphoma [2A85] [11]
Tisagenlecleucel DMM9BJD Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Tisagenlecleucel. Mature B-cell lymphoma [2A85] [11]
Mercaptopurine DMTM2IK Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Mercaptopurine. Mature B-cell lymphoma [2A85] [11]
Ponatinib DMYGJQO Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Ponatinib. Mature B-cell lymphoma [2A85] [11]
Cytarabine DMZD5QR Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Cytarabine. Mature B-cell lymphoma [2A85] [11]
Mechlorethamine DM0CVXA Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Mechlorethamine. Mature T-cell lymphoma [2A90] [11]
Dacarbazine DMNPZL4 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Dacarbazine. Melanoma [2C30] [11]
Interferon alfa-2B DMWCQP4 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Interferon alfa-2B. Melanoma [2C30] [11]
Carfilzomib DM48K0X Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Carfilzomib. Multiple myeloma [2A83] [11]
Panobinostat DM58WKG Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Panobinostat. Multiple myeloma [2A83] [11]
Lenalidomide DM6Q7U4 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Lenalidomide. Multiple myeloma [2A83] [11]
Thalidomide DM70BU5 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Thalidomide. Multiple myeloma [2A83] [11]
Selinexor DMBD4K3 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Selinexor. Multiple myeloma [2A83] [11]
Belantamab mafodotin DMBT3AI Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Belantamab mafodotin. Multiple myeloma [2A83] [11]
Elotuzumab DMEYHG9 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Elotuzumab. Multiple myeloma [2A83] [11]
Daratumumab DMKCIUZ Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Daratumumab. Multiple myeloma [2A83] [11]
Bortezomib DMNO38U Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Bortezomib. Multiple myeloma [2A83] [11]
Melphalan DMOLNHF Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Melphalan. Multiple myeloma [2A83] [11]
Tecfidera DM2OVDT Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Tecfidera. Multiple sclerosis [8A40] [11]
Siponimod DM2R86O Major Additive immunosuppressive effects by the combination of Alemtuzumab and Siponimod. Multiple sclerosis [8A40] [13]
Fingolimod DM5JVAN Major Additive immunosuppressive effects by the combination of Alemtuzumab and Fingolimod. Multiple sclerosis [8A40] [16]
Ocrelizumab DMEZ2KH Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Ocrelizumab. Multiple sclerosis [8A40] [17]
Ozanimod DMT6AM2 Major Additive immunosuppressive effects by the combination of Alemtuzumab and Ozanimod. Multiple sclerosis [8A40] [18]
Deflazacort DMV0RNS Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Deflazacort. Muscular dystrophy [8C70] [11]
Bexarotene DMOBIKY Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Bexarotene. Mycosis fungoides [2B01] [11]
Romidepsin DMT5GNL Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Romidepsin. Mycosis fungoides [2B01] [11]
Decitabine DMQL8XJ Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Decitabine. Myelodysplastic syndrome [2A37] [11]
Azacitidine DMTA5OE Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Azacitidine. Myelodysplastic syndrome [2A37] [11]
Nilotinib DM7HXWT Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Nilotinib. Myeloproliferative neoplasm [2A20] [11]
Ruxolitinib DM7Q98D Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Ruxolitinib. Myeloproliferative neoplasm [2A20] [11]
Imatinib DM7RJXL Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Imatinib. Myeloproliferative neoplasm [2A20] [11]
Dasatinib DMJV2EK Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Dasatinib. Myeloproliferative neoplasm [2A20] [11]
Hydroxyurea DMOQVU9 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Hydroxyurea. Myeloproliferative neoplasm [2A20] [11]
Omacetaxine mepesuccinate DMPU2WX Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Omacetaxine mepesuccinate. Myeloproliferative neoplasm [2A20] [19]
Busulfan DMXYJ9C Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Busulfan. Myeloproliferative neoplasm [2A20] [11]
Inebilizumab DMI0RHA Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Inebilizumab. Nervous system paraneoplastic/autoimmune disorder [8E4A] [11]
Atezolizumab DMMF8U0 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Atezolizumab. Non-small cell lung cancer [2C25] [11]
Olaparib DM8QB1D Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Olaparib. Ovarian cancer [2C73] [11]
Rucaparib DM9PVX8 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Rucaparib. Ovarian cancer [2C73] [11]
Carboplatin DMG281S Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Carboplatin. Ovarian cancer [2C73] [11]
Altretamine DMKLAYG Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Altretamine. Ovarian cancer [2C73] [11]
MK-4827 DMLYGH4 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and MK-4827. Ovarian cancer [2C73] [11]
Topotecan DMP6G8T Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Topotecan. Ovarian cancer [2C73] [11]
Aspirin DM672AH Moderate Increased risk of bleeding by the combination of Alemtuzumab and Aspirin. Pain [MG30-MG3Z] [20]
Diflunisal DM7EN8I Moderate Increased risk of bleeding by the combination of Alemtuzumab and Diflunisal. Pain [MG30-MG3Z] [13]
Ibuprofen DM8VCBE Moderate Increased risk of bleeding by the combination of Alemtuzumab and Ibuprofen. Pain [MG30-MG3Z] [13]
Trimethadione DM0Q8MZ Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Trimethadione. Pancreatic cancer [2C10] [11]
Streptozocin DMOF7AT Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Streptozocin. Pancreatic cancer [2C10] [11]
Levamisole DM5EN79 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Levamisole. Parasitic infection [1D0Y-1G2Z] [11]
Albendazole DMYZ57N Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Albendazole. Parasitic worm infestation [1F90] [11]
Pemetrexed DMMX2E6 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Pemetrexed. Pleural mesothelioma [2C26] [11]
Dapsone DM4LT8A Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Dapsone. Pneumonia [CA40] [11]
Prednisone DM2HG4X Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Prednisone. Postoperative inflammation [1A00-CA43] [11]
Betamethasone DMAHJEF Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Betamethasone. Postoperative inflammation [1A00-CA43] [11]
Hydrocortisone DMGEMB7 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Hydrocortisone. Postoperative inflammation [1A00-CA43] [11]
Brodalumab DMASDQ6 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Brodalumab. Psoriasis [EA90] [11]
Efalizumab DMCKL5V Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Efalizumab. Psoriasis [EA90] [21]
Ustekinumab DMHTYK3 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Ustekinumab. Psoriasis [EA90] [11]
Tildrakizumab DMLW9HG Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Tildrakizumab. Psoriasis [EA90] [11]
Risankizumab DMM32GT Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Risankizumab. Psoriasis [EA90] [11]
Ixekizumab DMXW92T Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Ixekizumab. Psoriasis [EA90] [11]
Everolimus DM8X2EH Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Everolimus. Renal cell carcinoma [2C90] [11]
Temsirolimus DMS104F Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Temsirolimus. Renal cell carcinoma [2C90] [11]
Penicillamine DM40EF6 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Penicillamine. Rheumatoid arthritis [FA20] [11]
Tocilizumab DM7J6OR Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Tocilizumab. Rheumatoid arthritis [FA20] [11]
Canakinumab DM8HLO5 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Canakinumab. Rheumatoid arthritis [FA20] [11]
Rilonacept DMGLUQS Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Rilonacept. Rheumatoid arthritis [FA20] [11]
Golimumab DMHZV7X Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Golimumab. Rheumatoid arthritis [FA20] [11]
Dexamethasone DMMWZET Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Dexamethasone. Rheumatoid arthritis [FA20] [11]
Sarilumab DMOGNXY Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Sarilumab. Rheumatoid arthritis [FA20] [11]
Leflunomide DMR8ONJ Major Additive myelosuppressive effects by the combination of Alemtuzumab and Leflunomide. Rheumatoid arthritis [FA20] [14]
Abatacept DMSA8RU Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Abatacept. Rheumatoid arthritis [FA20] [11]
Tolmetin DMWUIJE Moderate Increased risk of bleeding by the combination of Alemtuzumab and Tolmetin. Rheumatoid arthritis [FA20] [13]
Anthrax vaccine DM9GSWY Moderate Antagonize the effect of Alemtuzumab when combined with Anthrax vaccine. Sepsis [1G40-1G41] [22]
Mogamulizumab DMISH0Z Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Mogamulizumab. Sezary syndrome [2B02] [11]
Floxuridine DM04LR2 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Floxuridine. Solid tumour/cancer [2A00-2F9Z] [11]
Dactinomycin DM2YGNW Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Dactinomycin. Solid tumour/cancer [2A00-2F9Z] [11]
Methylprednisolone DM4BDON Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Methylprednisolone. Solid tumour/cancer [2A00-2F9Z] [11]
Cyclophosphamide DM4O2Z7 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Cyclophosphamide. Solid tumour/cancer [2A00-2F9Z] [11]
Vinblastine DM5TVS3 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Vinblastine. Solid tumour/cancer [2A00-2F9Z] [11]
PDX-101 DM6OC53 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and PDX-101. Solid tumour/cancer [2A00-2F9Z] [11]
Ifosfamide DMCT3I8 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Ifosfamide. Solid tumour/cancer [2A00-2F9Z] [11]
Docetaxel DMDI269 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Docetaxel. Solid tumour/cancer [2A00-2F9Z] [11]
Trabectedin DMG3Y89 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Trabectedin. Solid tumour/cancer [2A00-2F9Z] [11]
Mitoxantrone DMM39BF Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Mitoxantrone. Solid tumour/cancer [2A00-2F9Z] [11]
LEE011 DMMX75K Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and LEE011. Solid tumour/cancer [2A00-2F9Z] [11]
Etoposide DMNH3PG Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Etoposide. Solid tumour/cancer [2A00-2F9Z] [11]
Epirubicin DMPDW6T Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Epirubicin. Solid tumour/cancer [2A00-2F9Z] [11]
Prednisolone DMQ8FR2 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Prednisolone. Solid tumour/cancer [2A00-2F9Z] [11]
Cisplatin DMRHGI9 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Cisplatin. Solid tumour/cancer [2A00-2F9Z] [11]
Gemcitabine DMSE3I7 Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Gemcitabine. Solid tumour/cancer [2A00-2F9Z] [11]
Fluorouracil DMUM7HZ Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Fluorouracil. Solid tumour/cancer [2A00-2F9Z] [11]
Taxol DMUOT9V Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Taxol. Solid tumour/cancer [2A00-2F9Z] [11]
Doxorubicin DMVP5YE Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Doxorubicin. Solid tumour/cancer [2A00-2F9Z] [11]
Vinorelbine DMVXFYE Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Vinorelbine. Solid tumour/cancer [2A00-2F9Z] [11]
Pomalidomide DMTGBAX Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Pomalidomide. Systemic sclerosis [4A42] [11]
Plicamycin DM7C8YV Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Plicamycin. Testicular cancer [2C80] [11]
Argatroban DMFI46A Moderate Increased risk of bleeding by the combination of Alemtuzumab and Argatroban. Thrombosis [DB61-GB90] [13]
Trimetrexate DMDEA85 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Trimetrexate. Toxoplasmosis [1F57] [11]
Sirolimus DMGW1ID Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Sirolimus. Transplant rejection [NE84] [11]
Azathioprine DMMZSXQ Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Azathioprine. Transplant rejection [NE84] [11]
Mycophenolate mofetil DMPQAGE Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Mycophenolate mofetil. Transplant rejection [NE84] [11]
Belatacept DMXLYQF Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Belatacept. Transplant rejection [NE84] [11]
Tacrolimus DMZ7XNQ Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Tacrolimus. Transplant rejection [NE84] [11]
Durvalumab DM4PVDY Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Durvalumab. Ureteral cancer [2C92] [11]
Acetohydroxamic Acid DMYX7NI Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Acetohydroxamic Acid. Urinary tract infection [GC08] [11]
Triamcinolone DM98IXF Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Triamcinolone. Vasomotor/allergic rhinitis [CA08] [11]
Procainamide DMNMXR8 Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Procainamide. Ventricular tachyarrhythmia [BC71] [11]
Tocainide DMYNMDP Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Tocainide. Ventricular tachyarrhythmia [BC71] [11]
Ganciclovir DM1MBYQ Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Ganciclovir. Virus infection [1A24-1D9Z] [13]
Trifluridine DMG2YBD Moderate Additive immunosuppressive effects by the combination of Alemtuzumab and Trifluridine. Virus infection [1A24-1D9Z] [11]
Valganciclovir DMS2IUH Moderate Additive myelosuppressive effects by the combination of Alemtuzumab and Valganciclovir. Virus infection [1A24-1D9Z] [13]
⏷ Show the Full List of 178 DDI Information of This Drug

References

1 Fludarabine-melphalan conditioning for AML and MDS: alemtuzumab reduces acute and chronic GVHD without affecting long-term outcomes. Biol Blood Marrow Transplant. 2009 May;15(5):610-7.
2 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6770).
3 Secondary Immunodeficiency and Risk of Infection Following Immune Therapies in Neurology. CNS Drugs. 2021 Nov;35(11):1173-1188.
4 T-Cell Prolymphocytic Leukemia: Diagnosis, Pathogenesis, and Treatment. Int J Mol Sci. 2023 Jul 28;24(15):12106.
5 Alemtuzumab: validation of a sensitive and simple enzyme-linked immunosorbent assay. Leuk Res. 2004 Dec;28(12):1255-62.
6 Therapeutic Interventions of Tissue Specific Autoimmune Onset in Systemic Lupus Erythematosus. Mini Rev Med Chem. 2017;17(15):1418-1424.
7 Regulation of Monocyte Adhesion and Type I Interferon Signaling by CD52 in Patients With Systemic Sclerosis. Arthritis Rheumatol. 2021 Sep;73(9):1720-1730.
8 A standard database for drug repositioning. Sci Data. 2017 Mar 14;4:170029.
9 Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
10 Identifying alemtuzumab as an anti-myeloid cell antiangiogenic therapy for the treatment of ovarian cancer. J Transl Med. 2009 Jun 19;7:49.
11 Product Information. Campath (alemtuzumab) Berlex, Richmond, CA.
12 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
13 Cerner Multum, Inc. "Australian Product Information.".
14 Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
15 Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
16 Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
17 Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
18 Product Information. Zeposia (ozanimod). Celgene Corporation, Summit, NJ.
19 Product Information. Synribo (omacetaxine). Teva Pharmaceuticals USA, North Wales, PA.
20 Cerner Multum, Inc. "Canadian Product Information.".
21 Product Information. Raptiva (efalizumab). Genentech, South San Francisco, CA.
22 CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]