Details of the Drug

General Information of Drug (ID: DMZL3IV)

Drug Name

Alemtuzumab

Synonyms

Campath (TN); MabCampath (TN); Campath-1H (TN)

Indication

Disease Entry	ICD 11	Status	REF
Chronic lymphocytic leukaemia	2A82.0	Approved	[1], [2], [3]
Multiple sclerosis	8A40	Approved	[1], [2], [3]

Therapeutic Class

Anticancer Agents

Drug Type

Antibody

Sequence

>heavy chain 1
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT
EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>light chain 1
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR
>heavy chain 2
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT
EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>light chain 2
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR

ADMET Property

Half-life: The concentration or amount of drug in body reduced by one-half in 288 hours [4]
Metabolism: The drug is metabolized via opsonization via the reticuloendothelial system [5]
Vd: The volume of distribution (Vd) of drug is 0.18 L/kg [6]

Cross-matching ID

DrugBank ID: DB00087
TTD ID: D01ZYG

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Cambridge pathology 1 antigen (CD52)	TTQT5S9	CD52_HUMAN	Not Available	[7], [8], [9], [10]

------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Alemtuzumab

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Disease	REF
Pentostatin	DM0HXDS	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Pentostatin.	Mature B-cell leukaemia [2A82]	[12]
Ofatumumab	DM295PR	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Ofatumumab.	Mature B-cell leukaemia [2A82]	[12]
Obinutuzumab	DM3BVAE	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Obinutuzumab.	Mature B-cell leukaemia [2A82]	[12]
Cladribine	DM3JDRP	Major	Additive immunosuppressive effects by the combination of Alemtuzumab and Cladribine.	Mature B-cell leukaemia [2A82]	[13]
Idelalisib	DM602WT	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Idelalisib.	Mature B-cell leukaemia [2A82]	[12]
GDC-0199	DMH0QKA	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and GDC-0199.	Mature B-cell leukaemia [2A82]	[12]
Chlorambucil	DMRKE63	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Chlorambucil.	Mature B-cell leukaemia [2A82]	[12]
IPI-145	DMWA24P	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and IPI-145.	Mature B-cell leukaemia [2A82]	[12]
-----------


⏷ Show the Full List of 8 DDI Information of This Drug

Coadministration of a Drug Treating the Disease Different from Alemtuzumab (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Thioguanine	DM7NKEV	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Thioguanine.	Acute myeloid leukaemia [2A60]	[12]
Uracil mustard	DMHL7OB	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Uracil mustard.	Acute myeloid leukaemia [2A60]	[12]
Midostaurin	DMI6E0R	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Midostaurin.	Acute myeloid leukaemia [2A60]	[12]
Idarubicin	DMM0XGL	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Idarubicin.	Acute myeloid leukaemia [2A60]	[12]
Daunorubicin	DMQUSBT	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Daunorubicin.	Acute myeloid leukaemia [2A60]	[12]
Siltuximab	DMGEATB	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Siltuximab.	Anemia [3A00-3A9Z]	[12]
Budesonide	DMJIBAW	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Budesonide.	Asthma [CA23]	[12]
Roflumilast	DMPGHY8	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Roflumilast.	Asthma [CA23]	[13]
Dupilumab	DMOAD2Y	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Dupilumab.	Atopic eczema [EA80]	[12]
Chloramphenicol	DMFXEWT	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Chloramphenicol.	Bacterial infection [1A00-1C4Z]	[12]
Linezolid	DMGFPU2	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Linezolid.	Bacterial infection [1A00-1C4Z]	[12]
Temozolomide	DMKECZD	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Temozolomide.	Brain cancer [2A00]	[12]
Lomustine	DMMWSUL	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Lomustine.	Brain cancer [2A00]	[12]
Eribulin	DM1DX4Q	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Eribulin.	Breast cancer [2C60-2C6Y]	[12]
Talazoparib	DM1KS78	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Talazoparib.	Breast cancer [2C60-2C6Y]	[12]
Ixabepilone	DM2OZ3G	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Ixabepilone.	Breast cancer [2C60-2C6Y]	[12]
LY2835219	DM93VBZ	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and LY2835219.	Breast cancer [2C60-2C6Y]	[12]
Pralatrexate	DMAO80I	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Pralatrexate.	Breast cancer [2C60-2C6Y]	[12]
Palbociclib	DMD7L94	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Palbociclib.	Breast cancer [2C60-2C6Y]	[12]
Thiotepa	DMIZKOP	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Thiotepa.	Breast cancer [2C60-2C6Y]	[12]
Cabazitaxel	DMPAZHC	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Cabazitaxel.	Breast cancer [2C60-2C6Y]	[12]
Bosutinib	DMTI8YE	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Bosutinib.	Breast cancer [2C60-2C6Y]	[12]
Corticotropin	DMP9TWZ	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Corticotropin.	Chronic kidney disease [GB61]	[12]
Phenylbutazone	DMAYL0T	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Phenylbutazone.	Chronic pain [MG30]	[12]
Irinotecan	DMP6SC2	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Irinotecan.	Colorectal cancer [2B91]	[12]
Oxaliplatin	DMQNWRD	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Oxaliplatin.	Colorectal cancer [2B91]	[12]
Aflibercept	DMT3D5I	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Aflibercept.	Colorectal cancer [2B91]	[12]
Capecitabine	DMTS85L	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Capecitabine.	Colorectal cancer [2B91]	[12]
Ardeparin	DMYRX8B	Moderate	Increased risk of bleeding by the combination of Alemtuzumab and Ardeparin.	Coronary thrombosis [BA43]	[14]
Mycophenolic acid	DMU65NK	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Mycophenolic acid.	Crohn disease [DD70]	[12]
Polatuzumab vedotin	DMF6Y0L	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Polatuzumab vedotin.	Diffuse large B-cell lymphoma [2A81]	[12]
Axicabtagene ciloleucel	DMYHN59	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Axicabtagene ciloleucel.	Diffuse large B-cell lymphoma [2A81]	[12]
Flucytosine	DM13VTW	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Flucytosine.	Endocarditis [BB40-BA42]	[12]
Felbamate	DM1V5ZS	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Felbamate.	Epilepsy/seizure [8A61-8A6Z]	[12]
Mephenytoin	DM5UGDK	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Mephenytoin.	Epilepsy/seizure [8A61-8A6Z]	[12]
Paramethadione	DMR5ZUP	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Paramethadione.	Epilepsy/seizure [8A61-8A6Z]	[12]
Ethotoin	DMXWOCP	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Ethotoin.	Epilepsy/seizure [8A61-8A6Z]	[12]
Carbamazepine	DMZOLBI	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Carbamazepine.	Epilepsy/seizure [8A61-8A6Z]	[12]
Bay 80-6946	DMLOS5R	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Bay 80-6946.	Follicular lymphoma [2A80]	[12]
Pentamidine	DMHZJCG	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Pentamidine.	Fungal infection [1F29-1F2F]	[12]
Avapritinib	DMK2GZX	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Avapritinib.	Gastrointestinal stromal tumour [2B5B]	[12]
Colchicine	DM2POTE	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Colchicine.	Gout [FA25]	[12]
177Lu-DOTATATE	DMT8GVU	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and 177Lu-DOTATATE.	Hepatitis virus infection [1E50-1E51]	[12]
Bleomycin	DMNER5S	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Bleomycin.	Hodgkin lymphoma [2B30]	[12]
Brentuximab vedotin	DMWLC57	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Brentuximab vedotin.	Hodgkin lymphoma [2B30]	[12]
Zidovudine	DM4KI7O	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Zidovudine.	Human immunodeficiency virus disease [1C60-1C62]	[12]
Teriflunomide	DMQ2FKJ	Major	Additive immunosuppressive effects by the combination of Alemtuzumab and Teriflunomide.	Hyper-lipoproteinaemia [5C80]	[15]
Fludrocortisone	DMUDIR8	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Fludrocortisone.	Hypo-osmolality/hyponatraemia [5C72]	[12]
Auranofin	DMWE2N4	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Auranofin.	Inflammatory arthropathy [FA2Z]	[12]
Meclofenamic acid	DM05FXR	Moderate	Increased risk of bleeding by the combination of Alemtuzumab and Meclofenamic acid.	Inflammatory spondyloarthritis [FA92]	[14]
Olaratumab	DMNYOIX	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Olaratumab.	Kaposi sarcoma [2B57]	[12]
Methotrexate	DM2TEOL	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Methotrexate.	Leukaemia [2A60-2B33]	[12]
Nelarabine	DMB6VEG	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Nelarabine.	Leukaemia [2A60-2B33]	[12]
DTI-015	DMXZRW0	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and DTI-015.	Liver cancer [2C12]	[12]
Denosumab	DMNI0KO	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Denosumab.	Low bone mass disorder [FB83]	[16]
Brigatinib	DM7W94S	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Brigatinib.	Lung cancer [2C25]	[12]
Osimertinib	DMRJLAT	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Osimertinib.	Lung cancer [2C25]	[12]
Belimumab	DM3OBQF	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Belimumab.	Lupus erythematosus [4A40]	[12]
Primaquine	DMWQ16I	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Primaquine.	Malaria [1F40-1F45]	[12]
Inotuzumab ozogamicin	DMAC130	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Inotuzumab ozogamicin.	Malignant haematopoietic neoplasm [2B33]	[12]
Fludarabine	DMVRLT7	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Fludarabine.	Malignant haematopoietic neoplasm [2B33]	[12]
Acalabrutinib	DM7GCVW	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Acalabrutinib.	Mature B-cell lymphoma [2A85]	[12]
Clofarabine	DMCVJ86	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Clofarabine.	Mature B-cell lymphoma [2A85]	[12]
Blinatumomab	DMGECIJ	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Blinatumomab.	Mature B-cell lymphoma [2A85]	[12]
Ibrutinib	DMHZCPO	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Ibrutinib.	Mature B-cell lymphoma [2A85]	[12]
Vincristine	DMINOX3	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Vincristine.	Mature B-cell lymphoma [2A85]	[12]
Teniposide	DMLW57T	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Teniposide.	Mature B-cell lymphoma [2A85]	[12]
Tisagenlecleucel	DMM9BJD	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Tisagenlecleucel.	Mature B-cell lymphoma [2A85]	[12]
Mercaptopurine	DMTM2IK	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Mercaptopurine.	Mature B-cell lymphoma [2A85]	[12]
Ponatinib	DMYGJQO	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Ponatinib.	Mature B-cell lymphoma [2A85]	[12]
Cytarabine	DMZD5QR	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Cytarabine.	Mature B-cell lymphoma [2A85]	[12]
Mechlorethamine	DM0CVXA	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Mechlorethamine.	Mature T-cell lymphoma [2A90]	[12]
Dacarbazine	DMNPZL4	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Dacarbazine.	Melanoma [2C30]	[12]
Interferon alfa-2B	DMWCQP4	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Interferon alfa-2B.	Melanoma [2C30]	[12]
Carfilzomib	DM48K0X	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Carfilzomib.	Multiple myeloma [2A83]	[12]
Panobinostat	DM58WKG	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Panobinostat.	Multiple myeloma [2A83]	[12]
Lenalidomide	DM6Q7U4	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Lenalidomide.	Multiple myeloma [2A83]	[12]
Thalidomide	DM70BU5	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Thalidomide.	Multiple myeloma [2A83]	[12]
Selinexor	DMBD4K3	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Selinexor.	Multiple myeloma [2A83]	[12]
Belantamab mafodotin	DMBT3AI	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Belantamab mafodotin.	Multiple myeloma [2A83]	[12]
Elotuzumab	DMEYHG9	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Elotuzumab.	Multiple myeloma [2A83]	[12]
Daratumumab	DMKCIUZ	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Daratumumab.	Multiple myeloma [2A83]	[12]
Bortezomib	DMNO38U	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Bortezomib.	Multiple myeloma [2A83]	[12]
Melphalan	DMOLNHF	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Melphalan.	Multiple myeloma [2A83]	[12]
Tecfidera	DM2OVDT	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Tecfidera.	Multiple sclerosis [8A40]	[12]
Siponimod	DM2R86O	Major	Additive immunosuppressive effects by the combination of Alemtuzumab and Siponimod.	Multiple sclerosis [8A40]	[14]
Fingolimod	DM5JVAN	Major	Additive immunosuppressive effects by the combination of Alemtuzumab and Fingolimod.	Multiple sclerosis [8A40]	[17]
Ocrelizumab	DMEZ2KH	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Ocrelizumab.	Multiple sclerosis [8A40]	[18]
Ozanimod	DMT6AM2	Major	Additive immunosuppressive effects by the combination of Alemtuzumab and Ozanimod.	Multiple sclerosis [8A40]	[19]
Deflazacort	DMV0RNS	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Deflazacort.	Muscular dystrophy [8C70]	[12]
Bexarotene	DMOBIKY	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Bexarotene.	Mycosis fungoides [2B01]	[12]
Romidepsin	DMT5GNL	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Romidepsin.	Mycosis fungoides [2B01]	[12]
Decitabine	DMQL8XJ	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Decitabine.	Myelodysplastic syndrome [2A37]	[12]
Azacitidine	DMTA5OE	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Azacitidine.	Myelodysplastic syndrome [2A37]	[12]
Nilotinib	DM7HXWT	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Nilotinib.	Myeloproliferative neoplasm [2A20]	[12]
Ruxolitinib	DM7Q98D	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Ruxolitinib.	Myeloproliferative neoplasm [2A20]	[12]
Imatinib	DM7RJXL	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Imatinib.	Myeloproliferative neoplasm [2A20]	[12]
Dasatinib	DMJV2EK	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Dasatinib.	Myeloproliferative neoplasm [2A20]	[12]
Hydroxyurea	DMOQVU9	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Hydroxyurea.	Myeloproliferative neoplasm [2A20]	[12]
Omacetaxine mepesuccinate	DMPU2WX	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Omacetaxine mepesuccinate.	Myeloproliferative neoplasm [2A20]	[20]
Busulfan	DMXYJ9C	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Busulfan.	Myeloproliferative neoplasm [2A20]	[12]
Inebilizumab	DMI0RHA	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Inebilizumab.	Nervous system paraneoplastic/autoimmune disorder [8E4A]	[12]
Atezolizumab	DMMF8U0	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Atezolizumab.	Non-small cell lung cancer [2C25]	[12]
Olaparib	DM8QB1D	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Olaparib.	Ovarian cancer [2C73]	[12]
Rucaparib	DM9PVX8	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Rucaparib.	Ovarian cancer [2C73]	[12]
Carboplatin	DMG281S	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Carboplatin.	Ovarian cancer [2C73]	[12]
Altretamine	DMKLAYG	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Altretamine.	Ovarian cancer [2C73]	[12]
MK-4827	DMLYGH4	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and MK-4827.	Ovarian cancer [2C73]	[12]
Topotecan	DMP6G8T	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Topotecan.	Ovarian cancer [2C73]	[12]
Aspirin	DM672AH	Moderate	Increased risk of bleeding by the combination of Alemtuzumab and Aspirin.	Pain [MG30-MG3Z]	[21]
Diflunisal	DM7EN8I	Moderate	Increased risk of bleeding by the combination of Alemtuzumab and Diflunisal.	Pain [MG30-MG3Z]	[14]
Ibuprofen	DM8VCBE	Moderate	Increased risk of bleeding by the combination of Alemtuzumab and Ibuprofen.	Pain [MG30-MG3Z]	[14]
Trimethadione	DM0Q8MZ	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Trimethadione.	Pancreatic cancer [2C10]	[12]
Streptozocin	DMOF7AT	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Streptozocin.	Pancreatic cancer [2C10]	[12]
Levamisole	DM5EN79	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Levamisole.	Parasitic infection [1D0Y-1G2Z]	[12]
Albendazole	DMYZ57N	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Albendazole.	Parasitic worm infestation [1F90]	[12]
Pemetrexed	DMMX2E6	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Pemetrexed.	Pleural mesothelioma [2C26]	[12]
Dapsone	DM4LT8A	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Dapsone.	Pneumonia [CA40]	[12]
Prednisone	DM2HG4X	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Prednisone.	Postoperative inflammation [1A00-CA43]	[12]
Betamethasone	DMAHJEF	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Betamethasone.	Postoperative inflammation [1A00-CA43]	[12]
Hydrocortisone	DMGEMB7	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Hydrocortisone.	Postoperative inflammation [1A00-CA43]	[12]
Brodalumab	DMASDQ6	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Brodalumab.	Psoriasis [EA90]	[12]
Efalizumab	DMCKL5V	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Efalizumab.	Psoriasis [EA90]	[22]
Ustekinumab	DMHTYK3	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Ustekinumab.	Psoriasis [EA90]	[12]
Tildrakizumab	DMLW9HG	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Tildrakizumab.	Psoriasis [EA90]	[12]
Risankizumab	DMM32GT	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Risankizumab.	Psoriasis [EA90]	[12]
Ixekizumab	DMXW92T	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Ixekizumab.	Psoriasis [EA90]	[12]
Everolimus	DM8X2EH	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Everolimus.	Renal cell carcinoma [2C90]	[12]
Temsirolimus	DMS104F	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Temsirolimus.	Renal cell carcinoma [2C90]	[12]
Penicillamine	DM40EF6	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Penicillamine.	Rheumatoid arthritis [FA20]	[12]
Tocilizumab	DM7J6OR	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Tocilizumab.	Rheumatoid arthritis [FA20]	[12]
Canakinumab	DM8HLO5	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Canakinumab.	Rheumatoid arthritis [FA20]	[12]
Rilonacept	DMGLUQS	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Rilonacept.	Rheumatoid arthritis [FA20]	[12]
Golimumab	DMHZV7X	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Golimumab.	Rheumatoid arthritis [FA20]	[12]
Dexamethasone	DMMWZET	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Dexamethasone.	Rheumatoid arthritis [FA20]	[12]
Sarilumab	DMOGNXY	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Sarilumab.	Rheumatoid arthritis [FA20]	[12]
Leflunomide	DMR8ONJ	Major	Additive myelosuppressive effects by the combination of Alemtuzumab and Leflunomide.	Rheumatoid arthritis [FA20]	[15]
Abatacept	DMSA8RU	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Abatacept.	Rheumatoid arthritis [FA20]	[12]
Tolmetin	DMWUIJE	Moderate	Increased risk of bleeding by the combination of Alemtuzumab and Tolmetin.	Rheumatoid arthritis [FA20]	[14]
Anthrax vaccine	DM9GSWY	Moderate	Antagonize the effect of Alemtuzumab when combined with Anthrax vaccine.	Sepsis [1G40-1G41]	[23]
Mogamulizumab	DMISH0Z	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Mogamulizumab.	Sezary syndrome [2B02]	[12]
Floxuridine	DM04LR2	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Floxuridine.	Solid tumour/cancer [2A00-2F9Z]	[12]
Dactinomycin	DM2YGNW	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Dactinomycin.	Solid tumour/cancer [2A00-2F9Z]	[12]
Methylprednisolone	DM4BDON	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Methylprednisolone.	Solid tumour/cancer [2A00-2F9Z]	[12]
Cyclophosphamide	DM4O2Z7	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Cyclophosphamide.	Solid tumour/cancer [2A00-2F9Z]	[12]
Vinblastine	DM5TVS3	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Vinblastine.	Solid tumour/cancer [2A00-2F9Z]	[12]
PDX-101	DM6OC53	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and PDX-101.	Solid tumour/cancer [2A00-2F9Z]	[12]
Ifosfamide	DMCT3I8	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Ifosfamide.	Solid tumour/cancer [2A00-2F9Z]	[12]
Docetaxel	DMDI269	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Docetaxel.	Solid tumour/cancer [2A00-2F9Z]	[12]
Trabectedin	DMG3Y89	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Trabectedin.	Solid tumour/cancer [2A00-2F9Z]	[12]
Mitoxantrone	DMM39BF	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Mitoxantrone.	Solid tumour/cancer [2A00-2F9Z]	[12]
LEE011	DMMX75K	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and LEE011.	Solid tumour/cancer [2A00-2F9Z]	[12]
Etoposide	DMNH3PG	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Etoposide.	Solid tumour/cancer [2A00-2F9Z]	[12]
Epirubicin	DMPDW6T	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Epirubicin.	Solid tumour/cancer [2A00-2F9Z]	[12]
Prednisolone	DMQ8FR2	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Prednisolone.	Solid tumour/cancer [2A00-2F9Z]	[12]
Cisplatin	DMRHGI9	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Cisplatin.	Solid tumour/cancer [2A00-2F9Z]	[12]
Gemcitabine	DMSE3I7	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Gemcitabine.	Solid tumour/cancer [2A00-2F9Z]	[12]
Fluorouracil	DMUM7HZ	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Fluorouracil.	Solid tumour/cancer [2A00-2F9Z]	[12]
Taxol	DMUOT9V	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Taxol.	Solid tumour/cancer [2A00-2F9Z]	[12]
Doxorubicin	DMVP5YE	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Doxorubicin.	Solid tumour/cancer [2A00-2F9Z]	[12]
Vinorelbine	DMVXFYE	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Vinorelbine.	Solid tumour/cancer [2A00-2F9Z]	[12]
Pomalidomide	DMTGBAX	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Pomalidomide.	Systemic sclerosis [4A42]	[12]
Plicamycin	DM7C8YV	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Plicamycin.	Testicular cancer [2C80]	[12]
Argatroban	DMFI46A	Moderate	Increased risk of bleeding by the combination of Alemtuzumab and Argatroban.	Thrombosis [DB61-GB90]	[14]
Trimetrexate	DMDEA85	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Trimetrexate.	Toxoplasmosis [1F57]	[12]
Sirolimus	DMGW1ID	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Sirolimus.	Transplant rejection [NE84]	[12]
Azathioprine	DMMZSXQ	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Azathioprine.	Transplant rejection [NE84]	[12]
Mycophenolate mofetil	DMPQAGE	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Mycophenolate mofetil.	Transplant rejection [NE84]	[12]
Belatacept	DMXLYQF	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Belatacept.	Transplant rejection [NE84]	[12]
Tacrolimus	DMZ7XNQ	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Tacrolimus.	Transplant rejection [NE84]	[12]
Durvalumab	DM4PVDY	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Durvalumab.	Ureteral cancer [2C92]	[12]
Acetohydroxamic Acid	DMYX7NI	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Acetohydroxamic Acid.	Urinary tract infection [GC08]	[12]
Triamcinolone	DM98IXF	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Triamcinolone.	Vasomotor/allergic rhinitis [CA08]	[12]
Procainamide	DMNMXR8	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Procainamide.	Ventricular tachyarrhythmia [BC71]	[12]
Tocainide	DMYNMDP	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Tocainide.	Ventricular tachyarrhythmia [BC71]	[12]
Ganciclovir	DM1MBYQ	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Ganciclovir.	Virus infection [1A24-1D9Z]	[14]
Trifluridine	DMG2YBD	Moderate	Additive immunosuppressive effects by the combination of Alemtuzumab and Trifluridine.	Virus infection [1A24-1D9Z]	[12]
Valganciclovir	DMS2IUH	Moderate	Additive myelosuppressive effects by the combination of Alemtuzumab and Valganciclovir.	Virus infection [1A24-1D9Z]	[14]
-----------


⏷ Show the Full List of 178 DDI Information of This Drug

References

1	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6770).
2	Radium 223 dichloride for prostate cancer treatment. Drug Des Devel Ther. 2017 Sep 6;11:2643-2651.
3	New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21.
4	Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
5	FDA approval: ado-trastuzumab emtansine for the treatment of patients with HER2-positive metastatic breast cancer. Clin Cancer Res. 2014 Sep 1;20(17):4436-41.
6	An FDA phase I clinical trial of quinacrine sterilization (QS). Int J Gynaecol Obstet. 2003 Oct;83 Suppl 2:S45-9.
7	Identifying alemtuzumab as an anti-myeloid cell antiangiogenic therapy for the treatment of ovarian cancer. J Transl Med. 2009 Jun 19;7:49.
8	Clinical evaluation of busulfan, cladribine and alemtuzumab as reduced intensity conditioning for stem cell transplantation. Ann Transplant. 2009 Apr-Jun;14(2):7-12.
9	CD52 expression in peripheral T-cell lymphomas determined by combined immunophenotyping using tumor cell specific T-cell receptor antibodies. Leuk Lymphoma. 2009 Jun;50(6):1010-6.
10	Targeted therapy for chronic lymphocytic leukemia. Target Oncol. 2009 Jan;4(1):11-21.
11	Characterization of a Next Generation Anti-CD52 Antibody. Neurology. April 6, 2015 vol. 84 no. 14.
12	Product Information. Campath (alemtuzumab) Berlex, Richmond, CA.
13	Cerner Multum, Inc. "UK Summary of Product Characteristics.".
14	Cerner Multum, Inc. "Australian Product Information.".
15	Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
16	Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
17	Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
18	Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
19	Product Information. Zeposia (ozanimod). Celgene Corporation, Summit, NJ.
20	Product Information. Synribo (omacetaxine). Teva Pharmaceuticals USA, North Wales, PA.
21	Cerner Multum, Inc. "Canadian Product Information.".
22	Product Information. Raptiva (efalizumab). Genentech, South San Francisco, CA.
23	CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]