| DTT Name |
Jun N terminal kinase (JNK)
|
| Synonyms |
c-Jun N-terminal kinase; Stress-activated protein kinase JNK; SAPK1; PRKM; MAP kinase; JNK |
| Gene Name |
MAPK8
|
| DTT Type |
Clinical trial target
|
[1] |
| BioChemical Class |
Kinase
|
| UniProt ID |
MK08_HUMAN
; MK09_HUMAN
; MK10_HUMAN
|
| TTD ID |
|
| 3D Structure |
|
| Sequence |
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAA
GPLGCCR
|
| Function |
Associates with scaffold proteins JNK interacting proteins as well as their upstream kinases JNKK1 and JNKK2 following their activation. Modifies the activity of numerous proteins that reside at the mitochondria or act in the nucleus. Downstream molecules that are activated by JNK include c-Jun, ATF2, ELK1, SMAD4, p53 and HSF1. Involved in apoptosis, neurodegeneration, cell differentiation and proliferation, inflammatory conditions and cytokine production mediated by AP-1 (activation protein 1) such as RANTES, IL-8 and GM-CSF.
|
| KEGG Pathway |
- Endocrine resistance (hsa01522 )
- MAPK signaling pathway (hsa04010 )
- ErbB signaling pathway (hsa04012 )
- Ras signaling pathway (hsa04014 )
- cAMP signaling pathway (hsa04024 )
- FoxO signaling pathway (hsa04068 )
- Sphingolipid signaling pathway (hsa04071 )
- Mitophagy - animal (hsa04137 )
- Autophagy - animal (hsa04140 )
- Protein processing in endoplasmic reticulum (hsa04141 )
- Apoptosis (hsa04210 )
- Apoptosis - multiple species (hsa04215 )
- Necroptosis (hsa04217 )
- Wnt signaling pathway (hsa04310 )
- Osteoclast differentiation (hsa04380 )
- Focal adhesion (hsa04510 )
- Tight junction (hsa04530 )
- Toll-like receptor signaling pathway (hsa04620 )
- NOD-like receptor signaling pathway (hsa04621 )
- RIG-I-like receptor signaling pathway (hsa04622 )
- C-type lectin receptor signaling pathway (hsa04625 )
- IL-17 signaling pathway (hsa04657 )
- Th1 and Th2 cell differentiation (hsa04658 )
- Th17 cell differentiation (hsa04659 )
- T cell receptor signaling pathway (hsa04660 )
- Fc epsilon RI signaling pathway (hsa04664 )
- TNF signaling pathway (hsa04668 )
- Neurotrophin signaling pathway (hsa04722 )
- Retrograde endocannabinoid signaling (hsa04723 )
- Dopaminergic synapse (hsa04728 )
- Inflammatory mediator regulation of TRP channels (hsa04750 )
- Insulin signaling pathway (hsa04910 )
- GnRH signaling pathway (hsa04912 )
- Progesterone-mediated oocyte maturation (hsa04914 )
- Prolactin signaling pathway (hsa04917 )
- Adipocytokine signaling pathway (hsa04920 )
- Relaxin signaling pathway (hsa04926 )
- Type II diabetes mellitus (hsa04930 )
- Insulin resistance (hsa04931 )
- Non-alcoholic fatty liver disease (hsa04932 )
- AGE-RAGE signaling pathway in diabetic complications (hsa04933 )
- Growth hormone synthesis, secretion and action (hsa04935 )
- Alcoholic liver disease (hsa04936 )
- Alzheimer disease (hsa05010 )
- Parkinson disease (hsa05012 )
- Huntington disease (hsa05016 )
- Spinocerebellar ataxia (hsa05017 )
- Prion disease (hsa05020 )
- Pathways of neurodegeneration - multiple diseases (hsa05022 )
- Epithelial cell signaling in Helicobacter pylori infection (hsa05120 )
- Pathogenic Escherichia coli infection (hsa05130 )
- Shigellosis (hsa05131 )
- Salmonella infection (hsa05132 )
- Pertussis (hsa05133 )
- Yersinia infection (hsa05135 )
- Chagas disease (hsa05142 )
- Toxoplasmosis (hsa05145 )
- Tuberculosis (hsa05152 )
- Hepatitis B (hsa05161 )
- Measles (hsa05162 )
- Human T-cell leukemia virus 1 infection (hsa05166 )
- Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
- Epstein-Barr virus infection (hsa05169 )
- Human immunodeficiency virus 1 infection (hsa05170 )
- Coronavirus disease - COVID-19 (hsa05171 )
- Pathways in cancer (hsa05200 )
- Chemical carcinogenesis - reactive oxygen species (hsa05208 )
- Colorectal cancer (hsa05210 )
- Pancreatic cancer (hsa05212 )
- Choline metabolism in cancer (hsa05231 )
- Diabetic cardiomyopathy (hsa05415 )
- Lipid and atherosclerosis (hsa05417 )
- Fluid shear stress and atherosclerosis (hsa05418 )
|
| Reactome Pathway |
- Activation of BMF and translocation to mitochondria (R-HSA-139910 )
- NRAGE signals death through JNK (R-HSA-193648 )
- NRIF signals cell death from the nucleus (R-HSA-205043 )
- Oxidative Stress Induced Senescence (R-HSA-2559580 )
- FCERI mediated MAPK activation (R-HSA-2871796 )
- DSCAM interactions (R-HSA-376172 )
- JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1 (R-HSA-450321 )
- Activation of the AP-1 family of transcription factors (R-HSA-450341 )
- Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks (R-HSA-5693565 )
- Interleukin-38 signaling (R-HSA-9007892 )
- WNT5 (R-HSA-9673324 )
- Activation of BIM and translocation to mitochondria (R-HSA-111446 )
|
|
|
|
|
|
|
