Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTRICUF)

DTT Name Interleukin-18 (IL18)
Synonyms Interleukin-1 gamma; Interferon-gamma inducing factor; Interferon gamma-inducing factor; Iboctadekin; IL1F4; IL-18; IL-1 gamma; IGIF; IFN-gamma-inducing factor
Gene Name IL18
DTT Type
Clinical trial target
 [1]
BioChemical Class
Cytokine: interleukin
UniProt ID
IL18_HUMAN
TTD ID
T06671
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQ
GNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFK
EMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDEL
GDRSIMFTVQNED
Function
Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex which activates NF-kappa-B, triggering synthesis of inflammatory mediators. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells and natural killer (NK) cells. A proinflammatory cytokine primarily involved in polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses.
KEGG Pathway
Cytokine-cytokine receptor interaction (hsa04060 )
NOD-like receptor signaling pathway (hsa04621 )
Cytosolic DNA-sensing pathway (hsa04623 )
Salmonella infection (hsa05132 )
Legionellosis (hsa05134 )
African trypanosomiasis (hsa05143 )
Malaria (hsa05144 )
Tuberculosis (hsa05152 )
Influenza A (hsa05164 )
Inflammatory bowel disease (IBD) (hsa05321 )
Rheumatoid arthritis (hsa05323 )
Reactome Pathway
Interleukin-1 processing (R-HSA-448706 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
4 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Tadekinig alfa DM1NTVQ XIAP deficiency 4A01.22 Phase 3 [2]
GSK-1070806 DMQGPLO Type-2 diabetes 5A11 Phase 2 [1]
Iboctadekin DMHS29U Non-hodgkin lymphoma 2B33.5 Phase 1 [3]
MEDI-2338 DMCMYPX Chronic obstructive pulmonary disease CA22 Phase 1 [4]
------------------------------------------------------------------------------------
1 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
IL-18BP DMRSJ49 B-cell non-hodgkin lymphoma 2B33.5 Discontinued in Phase 1 [5]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTT
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Chronic obstructive pulmonary disease CA23 Lung tissue 5.59E-02 -0.14 -0.31
Chronic obstructive pulmonary disease CA23 Small airway epithelium 6.04E-02 -0.1 -0.21
Type 2 diabetes 5A11 Liver tissue 1.46E-01 0.12 1.81
Rheumatoid arthritis FA20 Synovial tissue 8.24E-02 0.15 0.25
Ovarian cancer 2C82 Ovarian tissue 9.80E-04 1.05 1.26
------------------------------------------------------------------------------------

References

1 Targeting the IL-1 family members in skin inflammation. Curr Opin Investig Drugs. 2010 November; 11(11): 1211-1220.
2 Clinical pipeline report, company report or official report of AB2 Bio.
3 Chemoimmunotherapy using pegylated liposomal Doxorubicin and interleukin-18 in recurrent ovarian cancer: a phase I dose-escalation study. Cancer Immunol Res. 2013 Sep;1(3):168-78.
4 Cytokine inhibition in the treatment of COPD. Int J Chron Obstruct Pulmon Dis. 2014; 9: 397-412.
5 Emerging drugs for rheumatoid arthritis. Expert Opin Emerg Drugs. 2008 Mar;13(1):175-96.