Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTSC2YM)

DTT Name	Mitochondrial uncoupling protein 2 (UCP2)
Synonyms	UCPH; UCP 2; Solute carrier family 25 member 8; SLC25A8
Gene Name	UCP2
DTT Type	Clinical trial target	[1]
BioChemical Class	Mitochondrial carrier
UniProt ID	UCP2_HUMAN
TTD ID	T84560
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGPVRATASAQYR GVMGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHASIGSRL LAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREEGFRGLWKGTS PNVARNAIVNCAELVTYDLIKDALLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT RYMNSALGQYSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA ACTSREAPF
Function	UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat.
Reactome Pathway	The proton buffering model (R-HSA-167827 ) The fatty acid cycling model (R-HSA-167826 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CL-316,243	DMXH1KC	Obesity	5B81	Phase 2	[1]
------------------------------------------------------------------------------------

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
NC-2100	DMJKZUC	Discovery agent	N.A.	Investigative	[2]
------------------------------------------------------------------------------------

The Drug Transporter (DTP) Role of This DTT

DTT DTP Name	Mitochondrial uncoupling protein 2 (SLC25A8) DTP Info
Gene Name	SLC25A8

References

1	Anti-obesity and anti-diabetic effects of CL316,243, a highly specific beta 3-adrenoceptor agonist, in Otsuka Long-Evans Tokushima Fatty rats: induction of uncoupling protein and activation of glucose transporter 4 in white fat. Eur J Endocrinol. 1997 Apr;136(4):429-37.
2	A new thiazolidinedione, NC-2100, which is a weak PPAR-gamma activator, exhibits potent antidiabetic effects and induces uncoupling protein 1 in white adipose tissue of KKAy obese mice. Diabetes. 2000 May;49(5):759-67.