General Information of Drug Therapeutic Target (DTT) (ID: TTSFWA7)

DTT Name Plasmodium CDK Pfmrk (Malaria Pfmrk)
Synonyms Pfmrk; MO15-related protein kinase Pfmrk
Gene Name Malaria Pfmrk
DTT Type
Patented-recorded target
[1]
BioChemical Class
Kinase
UniProt ID
P90584_PLAFA
TTD ID
T04820
EC Number
EC 2.7.1.37
Sequence
MENNSTERYIFKPNFLGEGSYGKVYKAYDTILKKEVAIKKMKLNEISNYIDDCGINFVLL
REIKIMKEIKHKNIMSALDLYCEKDYINLVMEIMDYDLSKIINRKIFLTDSQKKCILLQI
LNGLNVLHKYYFMHRDLSPANIFINKKGEVKLADFGLCTKYGYDMYSDKLFRDKYKKNLN
LTSKVVTLWYRAPELLLGSNKYNSSIDMWSFGCIFAELLLQKALFPGENEIDQLGKIFFL
LGTPNENNWPEALCLPLYTEFTKATKKDFKTYFKIDDDDCIDLLTSFLKLNAHERISAED
AMKHRYFFNDPLPCDISQLPFNDL
Function Association of Pfmrk with human cyclin H (the cyclin partner for hCDK7) or Pfcyc-1 (a cyclin homologue in P. falciparum) stimulates kinase activity in vitro.

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
1 Patented Agent(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
KENPAULLONE DMAGVXW Discovery agent N.A. Patented [1]
------------------------------------------------------------------------------------
20 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(E)-1-(4-Nitro-phenyl)-3-pyridin-2-yl-propenone DMEP903 Discovery agent N.A. Investigative [1]
2,5-dichloro-N-p-tolylthiophene-3-sulfonamide DMU5J8Y Discovery agent N.A. Investigative [2]
2,5-dichloro-N-phenylthiophene-3-sulfonamide DM9PK1R Discovery agent N.A. Investigative [2]
2-chloro-N-(o-tolylcarbamoyl)benzamide DMLDQ6I Discovery agent N.A. Investigative [2]
3-[3-(2-Hydroxy-ethoxy)-phenyl]-1H-quinolin-2-one DMLX9SI Discovery agent N.A. Investigative [1]
5-chloro-4-nitrothiophene-2-sulfonamide DMRS82Q Discovery agent N.A. Investigative [2]
5-Nitro-1H-indole-2,3-dione DMTS06Z Discovery agent N.A. Investigative [1]
APIGENIN DMI3491 Discovery agent N.A. Investigative [1]
N'-(2-fluorobenzoyl)-2-naphthohydrazide DM7BKUQ Discovery agent N.A. Investigative [2]
N-(2-aminoethyl)isoquinoline-5-sulfonamide DMG2MSX Discovery agent N.A. Investigative [3]
Oxindole derivative DM1AU8V Malaria 1F40-1F45 Investigative [4]
Thiophene sulfonamide DMAKW2S Malaria 1F40-1F45 Investigative [5]
WR-080539 DMUCGK8 Discovery agent N.A. Investigative [6]
WR-089120 DMT9WPJ Discovery agent N.A. Investigative [6]
WR-190706 DM3TI6L Discovery agent N.A. Investigative [6]
WR-203581 DM9M1UO Discovery agent N.A. Investigative [6]
WR-289009 DM5W9GR Discovery agent N.A. Investigative [6]
WR-289010 DMS2QUL Discovery agent N.A. Investigative [6]
WR-289012 DMG2LVM Discovery agent N.A. Investigative [6]
WR-289016 DMT08ZH Discovery agent N.A. Investigative [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 20 Investigative Drug(s)

References

1 A three-dimensional in silico pharmacophore model for inhibition of Plasmodium falciparum cyclin-dependent kinases and discovery of different class... J Med Chem. 2004 Oct 21;47(22):5418-26.
2 Activity of substituted thiophene sulfonamides against malarial and mammalian cyclin dependent protein kinases, Bioorg. Med. Chem. Lett. 20(13):3863-3867 (2010).
3 Evaluation of broad spectrum protein kinase inhibitors to probe the architecture of the malarial cyclin dependent protein kinase Pfmrk. Bioorg Med Chem Lett. 2007 Sep 1;17(17):4961-6.
4 Novel molecular targets for antimalarial chemotherapy. Int J Antimicrob Agents. 2007 Jul;30(1):4-10.
5 Novel molecular targets for antimalarial drug development. Chem Biol Drug Des. 2008 Apr;71(4):287-97.
6 Selective inhibition of Pfmrk, a Plasmodium falciparum CDK, by antimalarial 1,3-diaryl-2-propenones. Bioorg Med Chem Lett. 2009 Apr 1;19(7):1982-5.