Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTT3YKH)

• DTT Name: Somatotropin (GH1)
• Synonyms: Pituitary growth hormone; Growth hormone 1; Growth hormone; GH-N; GH
• Gene Name: GH1
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Somatotropin/prolactin
• UniProt ID: SOMA_HUMAN
• TTD ID: T19784
• Sequence:
  MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
  YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
  SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
  ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
• Function: Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Neuroactive ligand-receptor interaction (hsa04080)
  PI3K-Akt signaling pathway (hsa04151)
  Jak-STAT signaling pathway (hsa04630)
• Reactome Pathway:
  Growth hormone receptor signaling (R-HSA-982772)
  Prolactin receptor signaling (R-HSA-1170546)

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Lonapegsomatropin	DMPR8E9	Growth failure	LD2F.1Y	Approved	[2]

5 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Albutropin	DMWAL73	Growth failure	LD2F.1Y	Phase 3	[3]
HGH-CTP	DMXAZ47	Growth hormone deficiency	5A61.3	Phase 3	[1]
VRS-317	DMWMT5N	Growth hormone deficiency	5A61.3	Phase 3	[4]
Somatropin intranasal rhGH	DMK3RL8	Growth hormone deficiency	5A61.3	Phase 2	[5]
YPEG-Somatropin	DMCM0K6	Growth hormone deficiency	5A61.3	Phase 1	[6]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ARX-201	DMS0LCZ	Growth failure	LD2F.1Y	Discontinued in Phase 2	[7]

References

• [1] Developments in human growth hormone preparations: sustained-release, prolonged half-life, novel injection devices, and alternative delivery routes. Int J Nanomedicine. 2014; 9: 3527-3538.
• [2] ClinicalTrials.gov (NCT01947907) Safety, PK/PD and Efficacy of ACP-001 Weekly Versus Daily hGH in Children With Growth Hormone Deficiency (GHD). U.S. National Institutes of Health.
• [3] Albutropin: a growth hormone-albumin fusion with improved pharmacokinetics and pharmacodynamics in rats and monkeys. Eur J Pharmacol. 2002 Dec 5;456(1-3):149-58.
• [4] Company report (Versartis)
• [5] Long-term efficacy and safety of somatropin for adult growth hormone deficiency.Treat Endocrinol.2003;2(2):109-20.
• [6] Somatropin therapy in adults with Prader-Willi syndrome. Treat Endocrinol. 2004;3(3):153-60.
• [7] Company report (Avarx)