Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTTJUVZ)

DTT Name	Platelet glycoprotein VI (GP6)
Synonyms	Glycoprotein 6; GPVI
Gene Name	GP6
DTT Type	Clinical trial target	[1]
UniProt ID	GPVI_HUMAN
TTD ID	T60514
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MSPSPTALFCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLE KLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQP GPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRC YSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFT TETSRSITASPKESDSPAGPARQYYTKGNLVRICLGAVILIILAGFLAEDWHSRRKRLRH RGRAVQRPLPPLPPLPLTRKSNGGQDGGRQDVHSRGLCS
Function	Collagen receptor involved in collagen-induced platelet adhesion and activation. Plays a key role in platelet procoagulant activity and subsequent thrombin and fibrin formation. This procoagulant function may contribute to arterial and venous thrombus formation. The signaling pathway involves the FcR gamma-chain, the Src kinases (likely FYN or LYN) and SYK, the adapter protein LAT and leads to the activation of PLCG2.
KEGG Pathway	ECM-receptor interaction (hsa04512 ) Platelet activation (hsa04611 )
Reactome Pathway	Cell surface interactions at the vascular wall (R-HSA-202733 ) Platelet Adhesion to exposed collagen (R-HSA-75892 ) GPVI-mediated activation cascade (R-HSA-114604 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Revacept	DMJ37UX	Arteriosclerosis	BD40	Phase 2	[1]
ACT017	DMEU86T	Cerebral ischemia	8B11	Phase 1/2	[2]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Coronary artery disease	BA80-BA8Z	Peripheral blood	3.57E-01	0.03	0.26
------------------------------------------------------------------------------------

References

1	Novel antiplatelet drug revacept (Dimeric Glycoprotein VI-Fc) specifically and efficiently inhibited collagen-induced platelet aggregation without affecting general hemostasis in humans. Circulation.2011 May 3;123(17):1891-9.
2	Safety and Tolerability, Pharmacokinetics, and Pharmacodynamics of ACT017, an Antiplatelet GPVI (Glycoprotein VI) Fab. Arterioscler Thromb Vasc Biol. 2019 May;39(5):956-964.