Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTTLQFR)

• DTT Name: Transforming growth factor alpha (TGFA)
• Synonyms: TGF-alpha (40-89); TGF type 1 (40-89); Protransforming growth factor alpha (40-89); ETGF (40-89); EGF-like TGF (40-89)
• Gene Name: TGFA
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Growth factor
• UniProt ID: TGFA_HUMAN
• TTD ID: T00033
• Sequence:
  MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
  RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
  IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
• Function: TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
• KEGG Pathway:
  EGFR tyrosine kinase inhibitor resistance (hsa01521)
  MAPK signaling pathway (hsa04010)
  ErbB signaling pathway (hsa04012)
  Ras signaling pathway (hsa04014)
  PI3K-Akt signaling pathway (hsa04151)
  Estrogen signaling pathway (hsa04915)
  Pathways in cancer (hsa05200)
  Colorectal cancer (hsa05210)
  Renal cell carcinoma (hsa05211)
  Pancreatic cancer (hsa05212)
  Glioma (hsa05214)
  Prostate cancer (hsa05215)
  Non-small cell lung cancer (hsa05223)
  Hepatocellular carcinoma (hsa05225)
• Reactome Pathway:
  Cargo concentration in the ER (R-HSA-5694530)
  COPII (Coat Protein 2) Mediated Vesicle Transport (R-HSA-204005)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
LY3016859	DM7T1CR	Chronic kidney disease	GB61	Phase 1/2	[1]

References

• [1] Generation and activity of a humanized monoclonal antibody that selectively neutralizes the epidermal growth factor receptor ligands transforming growth factor-alpha and epiregulin. J Pharmacol Exp Ther. 2014 May;349(2):330-43.