Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTUMGNO)

• DTT Name: Ornithine decarboxylase (ODC1)
• Synonyms: ODC
• Gene Name: ODC1
• DTT Type: Successful target; [1]
• BioChemical Class: Carbon-carbon lyase
• UniProt ID: DCOR_HUMAN
• TTD ID: T60366
• EC Number: EC 4.1.1.17
• Sequence:
  MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALP
  RVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQI
  KYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLL
  LERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPG
  SEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVLKEQ
  TGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTC
  DGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQF
  QNPDFPPEVEEQDASTLPVSCAWESGMKRHRAACASASINV
• Function: Polyamines are essential for cell proliferation and are implicated in cellular processes, ranging from DNA replication to apoptosis. Catalyzes the first and rate-limiting step of polyamine biosynthesis that converts ornithine into putrescine, which is the precursor for the polyamines, spermidine and spermine.
• KEGG Pathway:
  Arginine and proline metabolism (hsa00330)
  Glutathione metabolism (hsa00480)
  Metabolic pathways (hsa01100)
• Reactome Pathway:
  Metabolism of polyamines (R-HSA-351202)
  Regulation of ornithine decarboxylase (ODC) (R-HSA-350562)
• BioCyc Pathway: MetaCyc:HS03935-MON

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Eflornithine	DMJOQM3	African trypanosomiasis	1F51	Approved	[1]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Putrescine	DMWE6V1	Burn and burn infection	ND90-NE2Z	Discontinued in Phase 2	[2]

16 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(2R,5R)-delta-methyl-alpha-acetylenic putrescine	DMSFXEO	Discovery agent	N.A.	Investigative	[1]
1-Amino-3-(aminoxy)-2-propanol Dihydrochloride	DMOAQC4	Discovery agent	N.A.	Investigative	[3]
3-(Aminooxy)propan-1-amine hydrochloride	DMPFH15	Discovery agent	N.A.	Investigative	[3]
3-methoxy-4-hydroxylonchocarpin	DMAL1CP	Discovery agent	N.A.	Investigative	[4]
4-hydroxylonchocarpin	DM36PHM	Discovery agent	N.A.	Investigative	[4]
Alpha-monofluoromethyl-3,4-dehydroornithine	DML7SU3	Discovery agent	N.A.	Investigative	[1]
Alpha-monofluoromethyl-3,4-dehydroornithine ethyl ester	DMJTGZV	Discovery agent	N.A.	Investigative	[1]
Alpha-monofluoromethyl-3,4-dehydroornithine methyl ester	DMGI9SM	Discovery agent	N.A.	Investigative	[1]
AMXT-1501	DMPSRZ0	Head and neck cancer	2D42	Investigative	[5]
APA	DMVG3K1	Discovery agent	N.A.	Investigative	[6]
G418	DMKTJBU	Discovery agent	N.A.	Investigative	[2]
LONCHOCARPUSONE	DMWFAPJ	Discovery agent	N.A.	Investigative	[4]
N'-Pyridoxyl-Lysine-5'-Monophosphate	DM3ZHBO	Discovery agent	N.A.	Investigative	[2]
N-Pyridoxyl-Glycine-5-Monophosphate	DMMV1YN	Discovery agent	N.A.	Investigative	[2]
Pyridoxine-5'-Phosphate	DMFUNL1	Discovery agent	N.A.	Investigative	[2]
ZAPOTIN	DMM4ZKU	Discovery agent	N.A.	Investigative	[7]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Head and neck cancer	2C82	Head and neck tissue	5.20E-35	1.58	2.43

References

• [1] Plasmodium falciparum and Plasmodium berghei: effects of ornithine decarboxylase inhibitors on erythrocytic schizogony. Exp Parasitol. 1987 Oct;64(2):237-43.
• [2] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [3] Selective delivery of 2-hydroxy APA to Trypanosoma brucei using the melamine motif. Bioorg Med Chem Lett. 2010 Aug 1;20(15):4364-6.
• [4] New bioactive flavonoids and stilbenes in cub resin insecticide. J Nat Prod. 1999 Feb;62(2):205-10.
• [5] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1276).
• [6] 2-substituted 3-(aminooxy)propanamines as inhibitors of ornithine decarboxylase: synthesis and biological activity. J Med Chem. 1992 Apr 17;35(8):1339-44.
• [7] Synthesis and cancer chemopreventive activity of zapotin, a natural product from Casimiroa edulis. J Med Chem. 2007 Jan 25;50(2):350-5.