Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTUQ7WN)

• DTT Name: Mitochondrial rRNA methyltransferase 2 (MRM2)
• Synonyms: rRNA methyltransferase 2, mitochondrial; Protein ftsJ homolog 2; 16S rRNA [Um1369] 2'-O-methyltransferase; 16S rRNA (uridine(1369)-2'-O)-methyltransferase
• Gene Name: MRM2
• DTT Type: Successful target; [1]
• Related Disease:
  Bronchitis [ICD-11: CA20]
  Prostate disease [ICD-11: GA91]
  Urinary tract infection [ICD-11: GC08]
• BioChemical Class: Methyltransferase
• UniProt ID: MRM2_HUMAN
• TTD ID: T98917
• EC Number: EC 2.1.1.-
• Sequence:
  MAGYLKLVCVSFQRQGFHTVGSRCKNRTGAEHLWLTRHLRDPFVKAAKVESYRCRSAFKL
  LEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLE
  GATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSV
  TPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRKESSEVYFLATQYHGR
  KGTVKQ
• Function: S-adenosyl-L-methionine-dependent 2'-O-ribose methyltransferase that catalyzes the formation of 2'-O-methyluridine at position 1369 (Um1369) in the 16S mitochondrial large subunit ribosomal RNA (mtLSU rRNA), a universally conserved modification in the peptidyl transferase domain of the mtLSU rRNA.

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Plazomicin	DMKMBES	Bronchitis	CA20	Approved	[1]

References

• [1] In vitro activity of plazomicin against -lactamase-producing carbapenem-resistant Enterobacteriaceae (CRE).J Antimicrob Chemother. 2017 Oct 1;72(10):2792-2795.