Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTV1AG6)

• DTT Name: Kidney-type arginase (ARG2)
• Synonyms: Non-hepatic arginase; Human penile arginase; Arginase II; ARG2
• Gene Name: ARG2
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Carbon-nitrogen hydrolase
• UniProt ID: ARGI2_HUMAN
• TTD ID: T36806
• EC Number: EC 3.5.3.1
• Sequence:
  MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSS
  LGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDH
  SLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPG
  FSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIG
  KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQ
  LATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQARVRI
• Function: May play a role in the regulation of extra-urea cycle arginine metabolism and also in down-regulation of nitric oxide synthesis. Extrahepatic arginase functions to regulate L-arginine bioavailability to NO synthase. Since NO synthase is found in the penile corpus cavernosum smooth muscle, the clitoral corpus cavernosum and the vagina, arginase II plays a role in both male and female sexual arousal. It is therefore a potential target for the treatment of male and female sexual arousal disorders.
• KEGG Pathway:
  Arginine and proline metabolism (hsa00330)
  Metabolic pathways (hsa01100)
  Biosynthesis of antibiotics (hsa01130)
  Biosynthesis of amino acids (hsa01230)
  Amoebiasis (hsa05146)
• Reactome Pathway: Urea cycle (R-HSA-70635)
• BioCyc Pathway: MetaCyc:HS01388-MON

Molecular Interaction Atlas (MIA) of This DTT

2 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
N-hydroxy-nor-L-arginine	DMCIAJL	N. A.	N. A.	Investigative	[1]
S-(2-boronoethyl)-L-cysteine	DMMZQB5	Discovery agent	N.A.	Investigative	[2]

References

• [1] Arginase reciprocally regulates nitric oxide synthase activity and contributes to endothelial dysfunction in aging blood vessels. Circulation. 2003 Oct 21;108(16):2000-6.
• [2] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.