Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTV8KWS)

• DTT Name: Vesicular acetylcholine transporter (SLC18A3)
• Synonyms: VAChT; Solute carrier family 18 member 3
• Gene Name: SLC18A3
• DTT Type: Discontinued target; [1]
• UniProt ID: VACHT_HUMAN
• TTD ID: T89772
• Sequence:
  MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVLVIVCVALLLDNMLYMVIVPIVPDY
  IAHMRGGGEGPTRTPEVWEPTLPLPTPANASAYTANTSASPTAAWPAGSALRPRYPTESE
  DVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVLFAFAEDYATLFA
  ARSLQGLGSAFADTSGIAMIADKYPEEPERSRALGVALAFISFGSLVAPPFGGILYEFAG
  KRVPFLVLAAVSLFDALLLLAVAKPFSAAARARANLPVGTPIHRLMLDPYIAVVAGALTT
  CNIPLAFLEPTIATWMKHTMAASEWEMGMAWLPAFVPHVLGVYLTVRLAARYPHLQWLYG
  ALGLAVIGASSCIVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSV
  YAIADISYSVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRS
  ERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS
• Function: Involved in acetylcholine transport into synaptic vesicles.
• KEGG Pathway:
  Synaptic vesicle cycle (hsa04721)
  Cholinergic synapse (hsa04725)
• Reactome Pathway:
  Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825)
  Clathrin-mediated endocytosis (R-HSA-8856828)
  Acetylcholine Neurotransmitter Release Cycle (R-HSA-264642)

Molecular Interaction Atlas (MIA) of This DTT

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
T-588	DM3M5TU	Amyotrophic lateral sclerosis	8B60.0	Discontinued in Phase 2	[1]

4 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
aminobenzovesamicol	DMCILV7	Discovery agent	N.A.	Investigative	[2]
vesamicol	DMHKUBG	Discovery agent	N.A.	Investigative	[2]
[123I]iodobenzovesamicol	DMOZGLM	Discovery agent	N.A.	Investigative	[3]
[3H]vesamicol	DM3MK8S	Discovery agent	N.A.	Investigative	[4]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Lateral sclerosis	8A00.0	Cervical spinal cord	2.53E-01	-0.15	-0.19

The Drug Transporter (DTP) Role of This DTT

• DTT DTP Name: Vesicular acetylcholine transporter (SLC18A3) DTP Info
• Gene Name: SLC18A3

1 Approved Drug(s) Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Acetylcholine	DMDF79Z	Cataract	9B10	Approved	[5]

References

• [1] Involvement of noradrenaline transporters in S-nitrosocysteine-stimulated noradrenaline release from rat brain slices: existence of functional Na(+)-independent transporter activity. Neurochem Int. 2001 Apr;38(4):323-31.
• [2] Vesamicol analogues as sigma ligands. Molecular determinants of selectivity at the vesamicol receptor. Biochem Pharmacol. 1995 Mar 15;49(6):791-7.
• [3] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1013).
• [4] Active transport of acetylcholine by the human vesicular acetylcholine transporter. J Biol Chem. 1996 Nov 1;271(44):27229-32.
• [5] SLC18: Vesicular neurotransmitter transporters for monoamines and acetylcholine. Mol Aspects Med. 2013 Apr-Jun;34(2-3):360-72.