Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTVHFE8)
DTT Name | Ammonium transporter Rh type A (RHAG) | ||||
---|---|---|---|---|---|
Synonyms |
Rhesus blood group-associated glycoprotein; Rhesus blood group-associated ammonia channel; Rhesus blood group family type A glycoprotein; Rh50A; Rh type A glycoprotein; Rh family type A glycoprotein; RH50; Erythrocyte plasma membrane 50 kDa glycoprotein; Erythrocyte membrane glycoprotein Rh50; CD241
|
||||
Gene Name | RHAG | ||||
DTT Type |
Literature-reported target
|
[1] | |||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFELYPLFQDVHVM
IFVGFGFLMTFLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADF SAATVLISFGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAY FGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAI VNTYFSLAACVLTAFAFSSLVEHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIG SIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLPGVVGGLAGIVAVAMGASNTSMAM QAAALGSSIGTAVVGGLMTGLILKLPLWGQPSDQNCYDDSVYWKVPKTR |
||||
Function |
Associated with rhesus blood group antigen expression. May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane. Involved in ammonia transport across the erythrocyte membrane. Seems to act in monovalent cation transport.
|
||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||