Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTWOMY8)

• DTT Name: Transforming growth factor beta 3 (TGFB3)
• Synonyms: Transforming growth factor beta-3 proprotein; Transforming growth factor beta-3; TGF-beta-3; Latency-associated peptide
• Gene Name: TGFB3
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Growth factor
• UniProt ID: TGFB3_HUMAN
• TTD ID: T22978
• Sequence:
  MKMHLQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPT
  VMTHVPYQVLALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNEL
  AVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHI
  AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
  NIHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR
  ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
  VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
• Function: Transforming growth factor beta-3 proprotein: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-3 (TGF-beta-3) chains, which constitute the regulatory and active subunit of TGF-beta-3, respectively.
• KEGG Pathway:
  MAPK signaling pathway (hsa04010)
  Cytokine-cytokine receptor interaction (hsa04060)
  FoxO signaling pathway (hsa04068)
  Cell cycle (hsa04110)
  Cellular senescence (hsa04218)
  TGF-beta signaling pathway (hsa04350)
  Hippo signaling pathway (hsa04390)
  AGE-RAGE signaling pathway in diabetic complications (hsa04933)
  Leishmaniasis (hsa05140)
  Chagas disease (hsa05142)
  Malaria (hsa05144)
  Toxoplasmosis (hsa05145)
  Amoebiasis (hsa05146)
  Tuberculosis (hsa05152)
  Hepatitis B (hsa05161)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Pathways in cancer (hsa05200)
  Colorectal cancer (hsa05210)
  Renal cell carcinoma (hsa05211)
  Pancreatic cancer (hsa05212)
  Chronic myeloid leukemia (hsa05220)
  Hepatocellular carcinoma (hsa05225)
  Gastric cancer (hsa05226)
  Inflammatory bowel disease (hsa05321)
  Rheumatoid arthritis (hsa05323)
  Hypertrophic cardiomyopathy (hsa05410)
  Dilated cardiomyopathy (hsa05414)
  Diabetic cardiomyopathy (hsa05415)
• Reactome Pathway:
  Molecules associated with elastic fibres (R-HSA-2129379)
  TGF-beta receptor signaling activates SMADs (R-HSA-2173789)
  ECM proteoglycans (R-HSA-3000178)
  Platelet degranulation (R-HSA-114608)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Avotermin	DMRJK3U	Sarcoidosis	4B20.5	Phase 3	[1]

References

• [1] Discovery and development of avotermin (recombinant human transforming growth factor beta 3): a new class of prophylactic therapeutic for the improvement of scarring. Wound Repair Regen. 2011 Sep;19 Suppl 1:s38-48.