Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTWRN6M)
DTT Name | CRP messenger RNA (CRP mRNA) | ||||
---|---|---|---|---|---|
Synonyms | PTX1 (mRNA); C-reactive protein (mRNA) | ||||
Gene Name | CRP | ||||
DTT Type |
Clinical trial target
|
[1] | |||
Related Disease |
|
||||
BioChemical Class |
mRNA target
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTE
LSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWES ASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMW DFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP |
||||
Function |
Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine.
|
||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
2 Clinical Trial Drug(s) Targeting This DTT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
7 Investigative Drug(s) Targeting This DTT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References