Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTWRN6M)

DTT Name CRP messenger RNA (CRP mRNA)
Synonyms PTX1 (mRNA); C-reactive protein (mRNA)
Gene Name CRP
DTT Type
Clinical trial target
 [1]
Related Disease
Coronary atherosclerosis [ICD-11: BA80]
Cardiovascular disease [ICD-11: BA00-BE2Z]
Postoperative inflammation [ICD-11: 1A00-CA43]
BioChemical Class
mRNA target
UniProt ID
CRP_HUMAN
TTD ID
T52953
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTE
LSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWES
ASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMW
DFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP
Function
Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine.
Reactome Pathway
Classical antibody-mediated complement activation (R-HSA-173623 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
2 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
ISIS-CRPRx DML84CN Coronary artery disease BA80 Phase 2 [1]
ISIS-CRP DMQDUG4 Cardiovascular disease BA00-BE2Z Phase 1 [2], [3]
------------------------------------------------------------------------------------
7 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
ISIS 133712 DMDZ3FU Discovery agent N.A. Investigative [4]
ISIS 133726 DMJ56XU Discovery agent N.A. Investigative [4]
ISIS 140180 DMP9WOZ Discovery agent N.A. Investigative [4]
ISIS 329956 DMA96KW Discovery agent N.A. Investigative [4]
ISIS 330012 DMWIVS9 Discovery agent N.A. Investigative [4]
ISIS 330031 DM35WFL Discovery agent N.A. Investigative [4]
Phosphocholine DMIZLVW Discovery agent N.A. Investigative [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Investigative Drug(s)

References

1 Antisense oligonucleotides on neurobehavior, respiratory, and cardiovascular function, and hERG channel current studies. J Pharmacol Toxicol Methods. 2014 Jan-Feb;69(1):49-60.
2 Clinical pipeline report, company report or official report of ISIS Pharmaceuticals (2009).
3 Clinical pipeline report, company report or official report of ISIS Pharmaceuticals (2011).
4 US patent application no. 7,425,545, Modulation of C-reactive protein expression.
5 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.