Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTWZRY5)
DTT Name | Sodium/bile acid cotransporter (SLC10A1) | ||||
---|---|---|---|---|---|
Synonyms | Solute carrier family 10 member 1; Sodium/taurocholate cotransporting polypeptide; Na(+)/taurocholate transport protein; Na(+)/bile acid cotransporter; Cell growth-inhibiting gene 29 protein | ||||
Gene Name | SLC10A1 | ||||
DTT Type |
Successful target
|
[1] | |||
Related Disease |
|
||||
BioChemical Class |
Bile acid:sodium symporter (BASS) (TC 2.A.28) family
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKG
LAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSI VMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKR PQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVL SALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLL IAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA |
||||
Function |
The hepatic sodium/bile acid uptake system exhibits broad substrate specificity and transports various non-bile acid organic compounds as well. It is strictly dependent on the extracellular presence of sodium.
|
||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Approved Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
The Drug Transporter (DTP) Role of This DTT
DTT DTP Name | Sodium/taurocholate cotransporting polypeptide (SLC10A1) | |||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Name | SLC10A1 | |||||||||||||||||||||||||||||||||||||||||||||||||||
5 Approved Drug(s) Transported by This DTT
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
2 Clinical Trial Drug(s) Transported by This DTT
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
References